You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMethylene-fatty-acyl-phospholipid synthase
Synonyms
  • Overproducer of inositol protein 3
  • Unsaturated phospholipid methyltransferase
Gene NameOPI3
Enzyme Class
Biological Properties
General FunctionInvolved in N-methyltransferase activity
Specific FunctionS-adenosyl-L-methionine + phospholipid olefinic fatty acid = S-adenosyl-L-homocysteine + phospholipid methylene fatty acid
Cellular LocationMembrane; Multi-pass membrane protein (Potential)
SMPDB Pathways
Lysolipid incorporation into ERPW002532 ThumbThumb?image type=greyscaleThumb?image type=simple
Lysolipid incorporation into ER PC(10:0/10:0)PW002780 ThumbThumb?image type=greyscaleThumb?image type=simple
Lysolipid incorporation into ER PC(14:0/14:0)PW002783 ThumbThumb?image type=greyscaleThumb?image type=simple
Lysolipid incorporation into ER PC(16:0/16:0)PW002784 ThumbThumb?image type=greyscaleThumb?image type=simple
Lysolipid incorporation into ER PC(16:1(11Z)/16:1(11Z))PW002786 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG PathwaysNot Available
SMPDB Reactions
PE-NMe(14:0/14:0) + S-Adenosyl-L-methioninePE-NMe2(14:0/14:0) + S-Adenosylhomocysteine + hydron
PE-NMe2(14:0/14:0) + S-Adenosyl-L-methionineS-Adenosylhomocysteine + hydron + PC(14:0/14:0)
PE-NMe2(14:0/14:0) + S-Adenosyl-L-methionineS-Adenosylhomocysteine + hydron + PC(16:0/16:0)
PE-NMe(16:0/16:0) + S-Adenosyl-L-methioninePE-NMe2(16:0/16:0) + S-Adenosylhomocysteine + hydron
PE-NMe2(16:0/16:0) + S-Adenosyl-L-methionineS-Adenosylhomocysteine + hydron + PC(16:0/16:0)
KEGG Reactions
PE(14:0/16:1(9Z)) + S-AdenosylmethionineS-Adenosylhomocysteine + phosphatidyl-N-methylethanolamine + hydron
phosphatidyl-N,N-dimethylethanolamine + S-Adenosylmethionine → phosphatidylcholine + S-Adenosylhomocysteine
phosphatidyl-N-methylethanolamine + S-Adenosylmethionine → phosphatidyl-N,N-dimethylethanolamine + S-Adenosylhomocysteine + hydron
Metabolites
YMDB IDNameView
YMDB00198S-AdenosylhomocysteineShow
YMDB00297S-AdenosylmethionineShow
YMDB00438S-Adenosyl-L-methionineShow
YMDB00862hydronShow
YMDB01180PC(16:0/16:0)Show
YMDB01185PC(16:1(9Z)/16:1(9Z))Show
YMDB01188PC(18:0/18:0)Show
YMDB01191PC(18:1(9Z)/18:1(9Z))Show
YMDB13563PC(10:0/10:0)Show
YMDB13570PC(14:0/14:0)Show
YMDB13626PC(16:1(11Z)/16:1(11Z))Show
YMDB13690PE-NMe2(10:0/10:0)Show
YMDB13691PE-NMe2(10:0/12:0)Show
YMDB13692PE-NMe2(10:0/14:0)Show
YMDB13693PE-NMe2(10:0/15:0)Show
YMDB13694PE-NMe2(10:0/16:0)Show
YMDB13695PE-NMe2(12:0/12:0)Show
YMDB13696PE-NMe2(12:0/14:0)Show
YMDB13697PE-NMe2(12:0/15:0)Show
YMDB13698PE-NMe2(14:0/14:0)Show
YMDB13699PE-NMe2(12:0/16:0)Show
YMDB13700PE-NMe2(14:0/15:0)Show
YMDB13701PE-NMe2(10:0/14:1(9Z))Show
YMDB13702PE-NMe2(10:0/14:1(11Z))Show
YMDB13703PE-NMe2(12:0/14:1(9Z))Show
YMDB13704PE-NMe2(12:0/14:1(11Z))Show
YMDB13705PE-NMe2(14:0/14:1(9Z))Show
YMDB13706PE-NMe2(14:0/14:1(11Z))Show
YMDB13707PE-NMe2(14:1(9Z)/15:0)Show
YMDB13708PE-NMe2(14:1(11Z)/15:0)Show
YMDB13709PE-NMe2(15:0/15:0)Show
YMDB13710PE-NMe2(10:0/20:1(13Z))Show
YMDB13711PE-NMe2(10:0/20:1(11Z))Show
YMDB13712PE-NMe2(10:0/15:1(9Z))Show
YMDB13713PE-NMe2(10:0/15:1(11Z))Show
YMDB13714PE-NMe2(10:0/16:1(9Z))Show
YMDB13715PE-NMe2(10:0/16:1(11Z))Show
YMDB13716PE-NMe2(12:0/18:1(9Z))Show
YMDB13717PE-NMe2(12:0/18:1(11Z))Show
YMDB13718PE-NMe2(12:0/15:1(9Z))Show
YMDB13719PE-NMe2(12:0/15:1(11Z))Show
YMDB13720PE-NMe2(14:0/16:1(9Z))Show
YMDB13721PE-NMe2(14:0/16:1(11Z))Show
YMDB13722PE-NMe2(14:0/15:1(9Z))Show
YMDB13723PE-NMe2(14:0/15:1(11Z))Show
YMDB13724PE-NMe2(14:1(9Z)/16:0)Show
YMDB13725PE-NMe2(14:1(11Z)/16:0)Show
YMDB13726PE-NMe2(15:0/15:1(9Z))Show
YMDB13727PE-NMe2(15:0/15:1(11Z))Show
YMDB13728PE-NMe2(12:0/16:1(9Z))Show
YMDB13729PE-NMe2(12:0/16:1(11Z))Show
YMDB13730PE-NMe2(14:1(9Z)/14:1(9Z))Show
YMDB13731PE-NMe2(14:1(9Z)/14:1(11Z))Show
YMDB13732PE-NMe2(14:1(11Z)/14:1(9Z))Show
YMDB13733PE-NMe2(14:1(11Z)/14:1(11Z))Show
YMDB13734PE-NMe2(14:1(9Z)/15:1(9Z))Show
YMDB13735PE-NMe2(14:1(9Z)/15:1(11Z))Show
YMDB13736PE-NMe2(14:1(11Z)/15:1(9Z))Show
YMDB13737PE-NMe2(14:1(11Z)/15:1(11Z))Show
YMDB13738PE-NMe2(14:1(9Z)/16:1(9Z))Show
YMDB13739PE-NMe2(14:1(9Z)/16:1(11Z))Show
YMDB13740PE-NMe2(14:1(11Z)/16:1(9Z))Show
YMDB13741PE-NMe2(14:1(11Z)/16:1(11Z))Show
YMDB13742PE-NMe2(15:1(9Z)/15:1(9Z))Show
YMDB13743PE-NMe2(15:1(9Z)/15:1(11Z))Show
YMDB13744PE-NMe2(15:1(11Z)/15:1(9Z))Show
YMDB13745PE-NMe2(15:1(11Z)/15:1(11Z))Show
YMDB13746PE-NMe2(15:1(9Z)/16:1(9Z))Show
YMDB13747PE-NMe2(15:1(9Z)/16:1(11Z))Show
YMDB13748PE-NMe2(15:1(11Z)/16:1(9Z))Show
YMDB13749PE-NMe2(15:1(11Z)/16:1(11Z))Show
YMDB13750PE-NMe2(14:0/16:0)Show
YMDB13751PE-NMe2(15:0/16:1(9Z))Show
YMDB13752PE-NMe2(15:0/16:1(11Z))Show
YMDB13753PE-NMe2(15:1(9Z)/16:0)Show
YMDB13754PE-NMe2(15:1(11Z)/16:0)Show
YMDB13755PE-NMe2(14:1(9Z)/18:1(9Z))Show
YMDB13756PE-NMe2(14:1(9Z)/18:1(11Z))Show
YMDB13757PE-NMe2(14:1(11Z)/18:1(9Z))Show
YMDB13758PE-NMe2(14:1(11Z)/18:1(11Z))Show
YMDB13759PE-NMe2(16:1(9Z)/16:1(9Z))Show
YMDB13760PE-NMe2(16:1(9Z)/16:1(11Z))Show
YMDB13761PE-NMe2(16:1(11Z)/16:1(9Z))Show
YMDB13762PE-NMe2(16:1(11Z)/16:1(11Z))Show
YMDB13763PE-NMe2(10:0/18:1(9Z))Show
YMDB13764PE-NMe2(10:0/18:1(11Z))Show
YMDB13765PE-NMe2(16:0/16:1(9Z))Show
YMDB13766PE-NMe2(16:0/16:1(11Z))Show
YMDB13767PE-NMe2(10:0/22:1(9Z))Show
YMDB13768PE-NMe2(10:0/22:1(11Z))Show
YMDB13769PE-NMe2(10:0/18:0)Show
YMDB13770PE-NMe2(12:0/20:1(13Z))Show
YMDB13771PE-NMe2(12:0/20:1(11Z))Show
YMDB13772PE-NMe2(14:0/18:1(9Z))Show
YMDB13773PE-NMe2(14:0/18:1(11Z))Show
YMDB13774PE-NMe2(14:1(9Z)/18:0)Show
YMDB13775PE-NMe2(14:1(11Z)/18:0)Show
YMDB13776PE-NMe2(16:0/16:0)Show
YMDB13777PE-NMe2(15:1(9Z)/18:1(9Z))Show
YMDB13778PE-NMe2(15:1(9Z)/18:1(11Z))Show
YMDB13779PE-NMe2(15:1(11Z)/18:1(9Z))Show
YMDB13780PE-NMe2(15:1(11Z)/18:1(11Z))Show
YMDB13781PE-NMe2(10:0/23:1(9Z))Show
YMDB13782PE-NMe2(10:0/23:1(11Z))Show
YMDB13783PE-NMe2(12:0/18:0)Show
YMDB13784PE-NMe2(15:0/18:1(9Z))Show
YMDB13785PE-NMe2(15:0/18:1(11Z))Show
YMDB13786PE-NMe2(15:1(9Z)/18:0)Show
YMDB13787PE-NMe2(15:1(11Z)/18:0)Show
YMDB13788PE-NMe2(14:1(9Z)/20:1(13Z))Show
YMDB13789PE-NMe2(14:1(9Z)/20:1(11Z))Show
YMDB13790PE-NMe2(14:1(11Z)/20:1(13Z))Show
YMDB13791PE-NMe2(14:1(11Z)/20:1(11Z))Show
YMDB13792PE-NMe2(16:1(9Z)/18:1(9Z))Show
YMDB13793PE-NMe2(16:1(9Z)/18:1(11Z))Show
YMDB13794PE-NMe2(16:1(11Z)/18:1(9Z))Show
YMDB13795PE-NMe2(16:1(11Z)/18:1(11Z))Show
YMDB13796PE-NMe2(10:0/24:1(9Z))Show
YMDB13797PE-NMe2(10:0/24:1(11Z))Show
YMDB13798PE-NMe2(12:0/22:1(9Z))Show
YMDB13799PE-NMe2(12:0/22:1(11Z))Show
YMDB13800PE-NMe2(14:0/20:1(13Z))Show
YMDB13801PE-NMe2(14:0/20:1(11Z))Show
YMDB13802PE-NMe2(14:0/18:0)Show
YMDB13803PE-NMe2(14:1(9Z)/20:0)Show
YMDB13804PE-NMe2(14:1(11Z)/20:0)Show
YMDB13805PE-NMe2(16:0/18:1(9Z))Show
YMDB13806PE-NMe2(16:0/18:1(11Z))Show
YMDB13807PE-NMe2(16:1(9Z)/18:0)Show
YMDB13808PE-NMe2(16:1(11Z)/18:0)Show
YMDB13809PE-NMe2(15:1(9Z)/20:1(13Z))Show
YMDB13810PE-NMe2(15:1(9Z)/20:1(11Z))Show
YMDB13811PE-NMe2(15:1(11Z)/20:1(13Z))Show
YMDB13812PE-NMe2(15:1(11Z)/20:1(11Z))Show
YMDB13813PE-NMe2(10:0/25:1(9Z))Show
YMDB13814PE-NMe2(10:0/25:1(11Z))Show
YMDB13815PE-NMe2(10:0/20:0)Show
YMDB13816PE-NMe2(12:0/23:1(9Z))Show
YMDB13817PE-NMe2(12:0/23:1(11Z))Show
YMDB13818PE-NMe2(15:0/20:1(13Z))Show
YMDB13819PE-NMe2(15:0/20:1(11Z))Show
YMDB13820PE-NMe2(15:0/16:0)Show
YMDB13821PE-NMe2(15:1(9Z)/20:0)Show
YMDB13822PE-NMe2(15:1(11Z)/20:0)Show
YMDB13823PE-NMe2(16:0/18:0)Show
YMDB13824PE-NMe2(14:1(9Z)/22:1(9Z))Show
YMDB13825PE-NMe2(14:1(9Z)/22:1(11Z))Show
YMDB13826PE-NMe2(14:1(11Z)/22:1(9Z))Show
YMDB13827PE-NMe2(14:1(11Z)/22:1(11Z))Show
YMDB13828PE-NMe2(16:1(9Z)/20:1(13Z))Show
YMDB13829PE-NMe2(16:1(9Z)/20:1(11Z))Show
YMDB13830PE-NMe2(16:1(11Z)/20:1(13Z))Show
YMDB13831PE-NMe2(16:1(11Z)/20:1(11Z))Show
YMDB13832PE-NMe2(18:1(9Z)/18:1(9Z))Show
YMDB13833PE-NMe2(18:1(9Z)/18:1(11Z))Show
YMDB13834PE-NMe2(18:1(11Z)/18:1(9Z))Show
YMDB13835PE-NMe2(18:1(11Z)/18:1(11Z))Show
YMDB13836PE-NMe2(18:0/18:1(9Z))Show
YMDB13837PE-NMe2(18:0/18:1(11Z))Show
YMDB13838PE-NMe2(10:0/26:1(9Z))Show
YMDB13839PE-NMe2(10:0/26:1(11Z))Show
YMDB13840PE-NMe2(12:0/24:1(9Z))Show
YMDB13841PE-NMe2(12:0/24:1(11Z))Show
YMDB13842PE-NMe2(12:0/20:0)Show
YMDB13843PE-NMe2(14:0/22:1(9Z))Show
YMDB13844PE-NMe2(14:0/22:1(11Z))Show
YMDB13845PE-NMe2(14:1(9Z)/22:0)Show
YMDB13846PE-NMe2(14:1(11Z)/22:0)Show
YMDB13847PE-NMe2(16:0/20:1(13Z))Show
YMDB13848PE-NMe2(16:0/20:1(11Z))Show
YMDB13849PE-NMe2(16:1(9Z)/20:0)Show
YMDB13850PE-NMe2(16:1(11Z)/20:0)Show
YMDB13851PE-NMe2(18:0/18:0)Show
YMDB13852PE-NMe(10:0/10:0)Show
YMDB13853PE-NMe(10:0/12:0)Show
YMDB13854PE-NMe(10:0/14:0)Show
YMDB13855PE-NMe(10:0/15:0)Show
YMDB13856PE-NMe(10:0/16:0)Show
YMDB13857PE-NMe(12:0/12:0)Show
YMDB13858PE-NMe(12:0/14:0)Show
YMDB13859PE-NMe(12:0/15:0)Show
YMDB13860PE-NMe(14:0/14:0)Show
YMDB13861PE-NMe(12:0/16:0)Show
YMDB13862PE-NMe(14:0/15:0)Show
YMDB13863PE-NMe(10:0/14:1(9Z))Show
YMDB13864PE-NMe(10:0/14:1(11Z))Show
YMDB13865PE-NMe(12:0/14:1(9Z))Show
YMDB13866PE-NMe(12:0/14:1(11Z))Show
YMDB13867PE-NMe(14:0/14:1(9Z))Show
YMDB13868PE-NMe(14:0/14:1(11Z))Show
YMDB13869PE-NMe(14:1(9Z)/15:0)Show
YMDB13870PE-NMe(14:1(11Z)/15:0)Show
YMDB13871PE-NMe(15:0/15:0)Show
YMDB13872PE-NMe(10:0/20:1(13Z))Show
YMDB13873PE-NMe(10:0/20:1(11Z))Show
YMDB13874PE-NMe(10:0/15:1(9Z))Show
YMDB13875PE-NMe(10:0/15:1(11Z))Show
YMDB13876PE-NMe(10:0/16:1(9Z))Show
YMDB13877PE-NMe(10:0/16:1(11Z))Show
YMDB13878PE-NMe(12:0/18:1(9Z))Show
YMDB13879PE-NMe(12:0/18:1(11Z))Show
YMDB13880PE-NMe(12:0/15:1(9Z))Show
YMDB13881PE-NMe(12:0/15:1(11Z))Show
YMDB13882PE-NMe(14:0/16:1(9Z))Show
YMDB13883PE-NMe(14:0/16:1(11Z))Show
YMDB13884PE-NMe(14:0/15:1(9Z))Show
YMDB13885PE-NMe(14:0/15:1(11Z))Show
YMDB13886PE-NMe(14:1(9Z)/16:0)Show
YMDB13887PE-NMe(14:1(11Z)/16:0)Show
YMDB13888PE-NMe(15:0/15:1(9Z))Show
YMDB13889PE-NMe(15:0/15:1(11Z))Show
YMDB13890PE-NMe(12:0/16:1(9Z))Show
YMDB13891PE-NMe(12:0/16:1(11Z))Show
YMDB13892PE-NMe(14:1(9Z)/14:1(9Z))Show
YMDB13893PE-NMe(14:1(9Z)/14:1(11Z))Show
YMDB13894PE-NMe(14:1(11Z)/14:1(9Z))Show
YMDB13895PE-NMe(14:1(11Z)/14:1(11Z))Show
YMDB13896PE-NMe(14:1(9Z)/15:1(9Z))Show
YMDB13897PE-NMe(14:1(9Z)/15:1(11Z))Show
YMDB13898PE-NMe(14:1(11Z)/15:1(9Z))Show
YMDB13899PE-NMe(14:1(11Z)/15:1(11Z))Show
YMDB13900PE-NMe(14:1(9Z)/16:1(9Z))Show
YMDB13901PE-NMe(14:1(9Z)/16:1(11Z))Show
YMDB13902PE-NMe(14:1(11Z)/16:1(9Z))Show
YMDB13903PE-NMe(14:1(11Z)/16:1(11Z))Show
YMDB13904PE-NMe(15:1(9Z)/15:1(9Z))Show
YMDB13905PE-NMe(15:1(9Z)/15:1(11Z))Show
YMDB13906PE-NMe(15:1(11Z)/15:1(9Z))Show
YMDB13907PE-NMe(15:1(11Z)/15:1(11Z))Show
YMDB13908PE-NMe(15:1(9Z)/16:1(9Z))Show
YMDB13909PE-NMe(15:1(9Z)/16:1(11Z))Show
YMDB13910PE-NMe(15:1(11Z)/16:1(9Z))Show
YMDB13911PE-NMe(15:1(11Z)/16:1(11Z))Show
YMDB13912PE-NMe(14:0/16:0)Show
YMDB13913PE-NMe(15:0/16:1(9Z))Show
YMDB13914PE-NMe(15:0/16:1(11Z))Show
YMDB13915PE-NMe(15:1(9Z)/16:0)Show
YMDB13916PE-NMe(15:1(11Z)/16:0)Show
YMDB13917PE-NMe(14:1(9Z)/18:1(9Z))Show
YMDB13918PE-NMe(14:1(9Z)/18:1(11Z))Show
YMDB13919PE-NMe(14:1(11Z)/18:1(9Z))Show
YMDB13920PE-NMe(14:1(11Z)/18:1(11Z))Show
YMDB13921PE-NMe(16:1(9Z)/16:1(9Z))Show
YMDB13922PE-NMe(16:1(9Z)/16:1(11Z))Show
YMDB13923PE-NMe(16:1(11Z)/16:1(9Z))Show
YMDB13924PE-NMe(16:1(11Z)/16:1(11Z))Show
YMDB13925PE-NMe(10:0/18:1(9Z))Show
YMDB13926PE-NMe(10:0/18:1(11Z))Show
YMDB13927PE-NMe(16:0/16:1(9Z))Show
YMDB13928PE-NMe(16:0/16:1(11Z))Show
YMDB13929PE-NMe(10:0/22:1(9Z))Show
YMDB13930PE-NMe(10:0/22:1(11Z))Show
YMDB13931PE-NMe(10:0/18:0)Show
YMDB13932PE-NMe(12:0/20:1(13Z))Show
YMDB13933PE-NMe(12:0/20:1(11Z))Show
YMDB13934PE-NMe(14:0/18:1(9Z))Show
YMDB13935PE-NMe(14:0/18:1(11Z))Show
YMDB13936PE-NMe(14:1(9Z)/18:0)Show
YMDB13937PE-NMe(14:1(11Z)/18:0)Show
YMDB13938PE-NMe(16:0/16:0)Show
YMDB13939PE-NMe(15:1(9Z)/18:1(9Z))Show
YMDB13940PE-NMe(15:1(9Z)/18:1(11Z))Show
YMDB13941PE-NMe(15:1(11Z)/18:1(9Z))Show
YMDB13942PE-NMe(15:1(11Z)/18:1(11Z))Show
YMDB13943PE-NMe(10:0/23:1(9Z))Show
YMDB13944PE-NMe(10:0/23:1(11Z))Show
YMDB13945PE-NMe(12:0/18:0)Show
YMDB13946PE-NMe(15:0/18:1(9Z))Show
YMDB13947PE-NMe(15:0/18:1(11Z))Show
YMDB13948PE-NMe(15:1(9Z)/18:0)Show
YMDB13949PE-NMe(15:1(11Z)/18:0)Show
YMDB13950PE-NMe(14:1(9Z)/20:1(13Z))Show
YMDB13951PE-NMe(14:1(9Z)/20:1(11Z))Show
YMDB13952PE-NMe(14:1(11Z)/20:1(13Z))Show
YMDB13953PE-NMe(14:1(11Z)/20:1(11Z))Show
YMDB13954PE-NMe(16:1(9Z)/18:1(9Z))Show
YMDB13955PE-NMe(16:1(9Z)/18:1(11Z))Show
YMDB13956PE-NMe(16:1(11Z)/18:1(9Z))Show
YMDB13957PE-NMe(16:1(11Z)/18:1(11Z))Show
YMDB13958PE-NMe(10:0/24:1(9Z))Show
YMDB13959PE-NMe(10:0/24:1(11Z))Show
YMDB13960PE-NMe(12:0/22:1(9Z))Show
YMDB13961PE-NMe(12:0/22:1(11Z))Show
YMDB13962PE-NMe(14:0/20:1(13Z))Show
YMDB13963PE-NMe(14:0/20:1(11Z))Show
YMDB13964PE-NMe(14:0/18:0)Show
YMDB13965PE-NMe(14:1(9Z)/20:0)Show
YMDB13966PE-NMe(14:1(11Z)/20:0)Show
YMDB13967PE-NMe(16:0/18:1(9Z))Show
YMDB13968PE-NMe(16:0/18:1(11Z))Show
YMDB13969PE-NMe(16:1(9Z)/18:0)Show
YMDB13970PE-NMe(16:1(11Z)/18:0)Show
YMDB13971PE-NMe(15:1(9Z)/20:1(13Z))Show
YMDB13972PE-NMe(15:1(9Z)/20:1(11Z))Show
YMDB13973PE-NMe(15:1(11Z)/20:1(13Z))Show
YMDB13974PE-NMe(15:1(11Z)/20:1(11Z))Show
YMDB13975PE-NMe(10:0/25:1(9Z))Show
YMDB13976PE-NMe(10:0/25:1(11Z))Show
YMDB13977PE-NMe(10:0/20:0)Show
YMDB13978PE-NMe(12:0/23:1(9Z))Show
YMDB13979PE-NMe(12:0/23:1(11Z))Show
YMDB13980PE-NMe(15:0/20:1(13Z))Show
YMDB13981PE-NMe(15:0/20:1(11Z))Show
YMDB13982PE-NMe(15:0/16:0)Show
YMDB13983PE-NMe(15:1(9Z)/20:0)Show
YMDB13984PE-NMe(15:1(11Z)/20:0)Show
YMDB13985PE-NMe(16:0/18:0)Show
YMDB13986PE-NMe(14:1(9Z)/22:1(9Z))Show
YMDB13987PE-NMe(14:1(9Z)/22:1(11Z))Show
YMDB13988PE-NMe(14:1(11Z)/22:1(9Z))Show
YMDB13989PE-NMe(14:1(11Z)/22:1(11Z))Show
YMDB13990PE-NMe(16:1(9Z)/20:1(13Z))Show
YMDB13991PE-NMe(16:1(9Z)/20:1(11Z))Show
YMDB13992PE-NMe(16:1(11Z)/20:1(13Z))Show
YMDB13993PE-NMe(16:1(11Z)/20:1(11Z))Show
YMDB13994PE-NMe(18:1(9Z)/18:1(9Z))Show
YMDB13995PE-NMe(18:1(9Z)/18:1(11Z))Show
YMDB13996PE-NMe(18:1(11Z)/18:1(9Z))Show
YMDB13997PE-NMe(18:1(11Z)/18:1(11Z))Show
YMDB13998PE-NMe(18:0/18:1(9Z))Show
YMDB13999PE-NMe(18:0/18:1(11Z))Show
YMDB14000PE-NMe(10:0/26:1(9Z))Show
YMDB14001PE-NMe(10:0/26:1(11Z))Show
YMDB14002PE-NMe(12:0/24:1(9Z))Show
YMDB14003PE-NMe(12:0/24:1(11Z))Show
YMDB14004PE-NMe(12:0/20:0)Show
YMDB14005PE-NMe(14:0/22:1(9Z))Show
YMDB14006PE-NMe(14:0/22:1(11Z))Show
YMDB14007PE-NMe(14:1(9Z)/22:0)Show
YMDB14008PE-NMe(14:1(11Z)/22:0)Show
YMDB14009PE-NMe(16:0/20:1(13Z))Show
YMDB14010PE-NMe(16:0/20:1(11Z))Show
YMDB14011PE-NMe(16:1(9Z)/20:0)Show
YMDB14012PE-NMe(16:1(11Z)/20:0)Show
YMDB14013PE-NMe(18:0/18:0)Show
YMDB15897PC(18:2(9Z,11Z)/18:2(9Z,11Z))Show
YMDB15898PC(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))Show
YMDB15899PE-NMe(18:2(9Z,11Z)/18:2(9Z,11Z))Show
YMDB15900PE-NMe(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))Show
YMDB15901PE-NMe2(18:2(9Z,11Z)/18:2(9Z,11Z))Show
YMDB15902PE-NMe2(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))Show
GO Classification
Component
Not Available
Function
N-methyltransferase activity
catalytic activity
transferase activity
transferase activity, transferring one-carbon groups
methyltransferase activity
Process
phospholipid metabolic process
metabolic process
organophosphate metabolic process
Gene Properties
Chromosome Locationchromosome 10
LocusYJR073C
Gene Sequence>621 bp ATGAAGGAGTCAGTCCAAGAGATCATCCAGCAACTCATCCACAGTGTCGATTTACAGTCT TCCAAGTTCCAGCTGGCCATTGTGTGCACGATGTTCAATCCTATCTTTTGGAACATCGTT GCAAGAATGGAATACCACAAGCATTCTCTCACCAAGATGTGTGGTGGGGCCAGAAAGGGC TGTTACATGTTGGCGGCGACCATATTTTCGCTAGGTATCGTCAGAGACATGGTGTACGAG TCTGCATTGCGTGAACAGCCTACGTGTTCTCTGATCACGGGCGAGAACTGGACCAAGCTG GGTGTGGCTCTCTTTGGTTTGGGGCAAGTGCTTGTTTTGAGTTCCATGTACAAGCTGGGT ATCACAGGGACGTACTTGGGTGACTATTTCGGCATCCTGATGGATGAGAGAGTCACCGGC TTCCCCTTCAACGTTTCCAACAACCCCATGTACCAGGGTTCCACTTTGTCCTTCTTGGGC ATAGCCCTTTACAAAGGAAAGCCTGCGGGGCTGGTTGTTTCTGCCGTAGTTTACTTCATG TACAAGATCGCTCTTCGTTGGGAAGAACCTTTTACTGCCATGATCTACGCTAACCGTGAT AAGGCCAAAAAGAATATGTAA
Protein Properties
Pfam Domain Function
Protein Residues206
Protein Molecular Weight23150.09961
Protein Theoretical pI9.26
Signalling Regions
  • None
Transmembrane Regions
  • 25-41
  • 100-117
Protein Sequence>Methylene-fatty-acyl-phospholipid synthase MKESVQEIIQQLIHSVDLQSSKFQLAIVCTMFNPIFWNIVARMEYHKHSLTKMCGGARKG CYMLAATIFSLGIVRDMVYESALREQPTCSLITGENWTKLGVALFGLGQVLVLSSMYKLG ITGTYLGDYFGILMDERVTGFPFNVSNNPMYQGSTLSFLGIALYKGKPAGLVVSAVVYFM YKIALRWEEPFTAMIYANRDKAKKNM
References
External Links
ResourceLink
Saccharomyces Genome Database OPI3
Uniprot IDP05375
Uniprot NamePEM2_YEAST
GenBank Gene IDAY557899
Genebank Protein ID45269689
General Reference
  • Kodaki, T., Yamashita, S. (1987). "Yeast phosphatidylethanolamine methylation pathway. Cloning and characterization of two distinct methyltransferase genes." J Biol Chem 262:15428-15435.2445736
  • Huang, M. E., Manus, V., Chuat, J. C., Galibert, F. (1996). "Analysis of a 62 kb DNA sequence of chromosome X reveals 36 open reading frames and a gene cluster with a counterpart on chromosome XI." Yeast 12:869-875.8840504
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106