You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameArginine permease
SynonymsNot Available
Gene NameCAN1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transport
Specific FunctionHigh-affinity permease for arginine
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00592L-ArginineShow
YMDB00862hydronShow
GO Classification
Component
cell part
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
transporter activity
transmembrane transporter activity
active transmembrane transporter activity
amine transmembrane transporter activity
amino acid transmembrane transporter activity
Process
amine transport
amino acid transport
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 5
LocusYEL063C
Gene Sequence>1773 bp ATGACAAATTCAAAAGAAGACGCCGACATAGAGGAGAAGCATATGTACAATGAGCCGGTC ACAACCCTCTTTCACGACGTTGAAGCTTCACAAACACACCACAGACGTGGGTCAATACCA TTGAAAGATGAGAAAAGTAAAGAATTGTATCCATTGCGCTCTTTCCCGACGAGAGTAAAT GGCGAGGATACGTTCTCTATGGAGGATGGCATAGGTGATGAAGATGAAGGAGAAGTACAG AACGCTGAAGTGAAGAGAGAGCTTAAGCAAAGACATATTGGTATGATTGCCCTTGGTGGT ACTATTGGTACAGGTCTTTTCATTGGTTTATCCACACCTCTGACCAACGCCGGCCCAGTG GGCGCTCTTATATCATATTTATTTATGGGTTCTTTGGCATATTCTGTCACGCAGTCCTTG GGTGAAATGGCTACATTCATCCCTGTTACATCCTCTTTCACAGTTTTCTCACAAAGATTC CTTTCTCCAGCATTTGGTGCGGCCAATGGTTACATGTATTGGTTTTCTTGGGCAATCACT TTTGCCCTGGAACTTAGTGTAGTTGGCCAAGTCATTCAATTTTGGACGTACAAAGTTCCA CTGGCGGCATGGATTAGTATTTTTTGGGTAATTATCACAATAATGAACTTGTTCCCTGTC AAATATTACGGTGAATTCGAGTTCTGGGTCGCTTCCATCAAAGTTTTAGCCATTATCGGG TTTCTAATATACTGTTTTTGTATGGTTTGTGGTGCTGGGGTTACCGGCCCAGTTGGATTC CGTTATTGGAGAAACCCAGGTGCCTGGGGTCCAGGTATAATATCTAAGGATAAAAACGAA GGGAGGTTCTTAGGTTGGGTTTCCTCTTTGATTAACGCTGCCTTCACATTTCAAGGTACT GAACTAGTTGGTATCACTGCTGGTGAAGCTGCAAACCCCAGAAAATCCGTTCCAAGAGCC ATCAAAAAAGTTGTTTTCCGTATCTTAACCTTCTACATTGGCTCTCTATTATTCATTGGA CTTTTAGTTCCATACAATGACCCTAAACTAACACAATCTACTTCCTACGTTTCTACTTCT CCCTTTATTATTGCTATTGAGAACTCTGGTACAAAGGTTTTGCCACATATCTTCAACGCT GTTATCTTAACAACCATTATTTCTGCCGCAAATTCAAATATTTACGTTGGTTCCCGTATT TTATTTGGTCTATCAAAGAACAAGTTGGCTCCTAAATTCCTGTCAAGGACCACCAAAGGT GGTGTTCCATACATTGCAGTTTTCGTTACTGCTGCATTTGGCGCTTTGGCTTACATGGAG ACATCTACTGGTGGTGACAAAGTTTTCGAATGGCTATTAAATATCACTGGTGTTGCAGGC TTTTTTGCATGGTTATTTATCTCAATCTCGCACATCAGATTTATGCAAGCTTTGAAATAC CGTGGCATCTCTCGTGACGAGTTACCATTTAAAGCTAAATTAATGCCCGGCTTGGCTTAT TATGCGGCCACATTTATGACGATCATTATCATTATTCAAGGTTTCACGGCTTTTGCACCA AAATTCAATGGTGTTAGCTTTGCTGCCGCCTATATCTCTATTTTCCTGTTCTTAGCTGTT TGGATCTTATTTCAATGCATATTCAGATGCAGATTTATTTGGAAGATTGGAGATGTCGAC ATCGATTCCGATAGAAGAGACATTGAGGCAATTGTATGGGAAGATCATGAACCAAAGACT TTTTGGGACAAATTTTGGAATGTTGTAGCATAG
Protein Properties
Pfam Domain Function
Protein Residues590
Protein Molecular Weight65784.79688
Protein Theoretical pI8.59
Signalling Regions
  • None
Transmembrane Regions
  • 93-110
  • 230-254
  • 324-343
  • 377-396
  • 420-437
  • 451-469
  • 494-518
  • 525-548
Protein Sequence>Arginine permease MTNSKEDADIEEKHMYNEPVTTLFHDVEASQTHHRRGSIPLKDEKSKELYPLRSFPTRVN GEDTFSMEDGIGDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPV GALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAIT FALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIG FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGT ELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTS PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKG GVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKY RGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAV WILFQCIFRCRFIWKIGDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA
References
External Links
ResourceLink
Saccharomyces Genome Database CAN1
Uniprot IDP04817
Uniprot NameCAN1_YEAST
GenBank Gene IDM11724
Genebank Protein ID171155
General Reference
  • Ahmad, M., Bussey, H. (1986). "Yeast arginine permease: nucleotide sequence of the CAN1 gene." Curr Genet 10:587-592.3327612
  • Hoffmann, W. (1985). "Molecular characterization of the CAN1 locus in Saccharomyces cerevisiae. A transmembrane protein without N-terminal hydrophobic signal sequence." J Biol Chem 260:11831-11837.3900064
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Regenberg, B., During-Olsen, L., Kielland-Brandt, M. C., Holmberg, S. (1999). "Substrate specificity and gene expression of the amino-acid permeases in Saccharomyces cerevisiae." Curr Genet 36:317-328.10654085
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356