You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameArgininosuccinate lyase
Synonyms
  • ASAL
  • Arginosuccinase
Gene NameARG4
Enzyme Class
Biological Properties
General FunctionInvolved in argininosuccinate lyase activity
Specific Function2-(N(omega)-L-arginino)succinate = fumarate + L-arginine
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Alanine, aspartate and glutamate metabolismec00250 Map00250
Arginine and proline metabolismec00330 Map00330
SMPDB Reactions
Argininosuccinic acid → Fumaric acid + L-Arginine
KEGG Reactions
Argininosuccinic acidL-Arginine + Fumaric acid
Metabolites
YMDB IDNameView
YMDB00052Argininosuccinic acidShow
YMDB00101Fumaric acidShow
YMDB00592L-ArginineShow
YMDB00593(N(omega)-L-arginino)succinic acidShow
GO Classification
Component
Not Available
Function
carbon-nitrogen lyase activity
amidine-lyase activity
catalytic activity
argininosuccinate lyase activity
lyase activity
Process
arginine metabolic process
arginine biosynthetic process
metabolic process
arginine biosynthetic process via ornithine
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
glutamine family amino acid metabolic process
Gene Properties
Chromosome Locationchromosome 8
LocusYHR018C
Gene Sequence>1392 bp ATGTCAGACGGCACTCAAAAACTATGGGGTGGGAGATTCACTGGTGAAACCGATCCTTTG ATGCACCTTTACAATGCGTCTCTTCCGTATGATTATAAGATGTATAAGGCAGATTTAGAA GGAACTAAAGTATACACAGCGGGCTTGCAGAAGTTGGGTCTTCTAACGGAGACAGAATTG GCAAAGATCCATGAAGGTTTGGCTGAAATCAAAAAAGAATGGGACGCTGACAAATTTGTC CGTCATCCAAACGACGAGGATATCCATACTGCGAATGAAAGACGTCTTGGTGAACTAATT GGCCGCGATATTGCTGGTAAAGTCCACACCGGTAGATCCCGTAATGATCAAGTTGTTACC GATTTGAGAATATACTGTCGTGACATTGTCAATGACACCCTCTTTCCAGCTTTAAAGGGC TTGGTTGAAGTTCTAATTAAGAGGGCCGAAGGTGAGATAGATGTCTTAATGCCAGGCTAC ACACATTTACAAAGGGCACAACCTATTAGATGGTCTCATTGGTTGAGCTCTTATGCAACA TACTTCACCGAAGATTACAAGAGACTGGGTCAAATACTACACAGATTGAATCAATCACCA CTGGGTGCAGGCGCTCTTGCTGGTCATCCTTACGGCATTGATAGAGAATTTTTGGCTGAA GGTTTGGGTTTCAATAGTGTAATTGGTAACTCCTTGGTTGCTGTTTCTGATAGAGATTTC ATCGTGGAGTTGATGTTTTGGGGAACTTTGTTCATGAACCATATTTCTCGTTTTGCTGAA GATTTGATTATATATTGTACAGCAGAATTTGGTTTCATACAGTTGAGCGACGCCTATTCA ACAGGTTCTTCTTTAATGCCTCAGAAGAAGAATGCAGACTCGTTAGAGTTGTTAAGAGGT AAATCCGGTAGAGTATTTGGTGATCTGACAGGATTCTTGATGAGTTTGAAGGGTATCCCA TCTACTTATGATAAAGACATGCAAGAAGACAAAGAGCCACTATTCGATTGCTTAACAACT GTAGAGCACTCCATGCTGATTGCCACAGGTGTTATTTCTACCTTAACTGTAAATAAGGAA AAGATGGAAGCTGCTCTCACGATGGATATGCTAGCTACCGACTTGGCAGATTACTTGGTC AGAAAGGGTGTTCCATTCAGAGAGACTCATCACATATCTGGTGAGTGTGTCGCTACTGCT GAAAGACTTGGTCTAAGCGGTATTGATAAATTAACCTTGGAGCAGTATCAAAAGATCGAT TCGAGATTCGGACAAGATCTTTTTGAAACTTTTAACTTTGAACAAAGCGTTGAAAGACGA GATGCTACTGGTGGAACCGCTAAATCTGCTGTATTGAAGCAATTGGATAATTTGAAATCC CAATTAAATTAG
Protein Properties
Pfam Domain Function
Protein Residues463
Protein Molecular Weight51988.69922
Protein Theoretical pI5.48
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Argininosuccinate lyase MSDGTQKLWGGRFTGETDPLMHLYNASLPYDYKMYKADLEGTKVYTAGLQKLGLLTETEL AKIHEGLAEIKKEWDADKFVRHPNDEDIHTANERRLGELIGRDIAGKVHTGRSRNDQVVT DLRIYCRDIVNDTLFPALKGLVEVLIKRAEGEIDVLMPGYTHLQRAQPIRWSHWLSSYAT YFTEDYKRLGQILHRLNQSPLGAGALAGHPYGIDREFLAEGLGFNSVIGNSLVAVSDRDF IVELMFWGTLFMNHISRFAEDLIIYCTAEFGFIQLSDAYSTGSSLMPQKKNADSLELLRG KSGRVFGDLTGFLMSLKGIPSTYDKDMQEDKEPLFDCLTTVEHSMLIATGVISTLTVNKE KMEAALTMDMLATDLADYLVRKGVPFRETHHISGECVATAERLGLSGIDKLTLEQYQKID SRFGQDLFETFNFEQSVERRDATGGTAKSAVLKQLDNLKSQLN
References
External Links
ResourceLink
Saccharomyces Genome Database ARG4
Uniprot IDP04076
Uniprot NameARLY_YEAST
GenBank Gene IDAY693155
Genebank Protein ID51013761
General Reference
  • Beacham, I. R., Schweitzer, B. W., Warrick, H. M., Carbon, J. (1984). "The nucleotide sequence of the yeast ARG4 gene." Gene 29:271-279.6386606
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • White, J. H., Lusnak, K., Fogel, S. (1985). "Mismatch-specific post-meiotic segregation frequency in yeast suggests a heteroduplex recombination intermediate." Nature 315:350-352.3889658
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956