You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameInvertase 2
Synonyms
  • Beta-fructofuranosidase 2
  • Saccharase
Gene NameSUC2
Enzyme Class
Biological Properties
General FunctionInvolved in hydrolase activity, hydrolyzing O-glycosyl compounds
Specific FunctionHydrolysis of terminal non-reducing beta-D- fructofuranoside residues in beta-D-fructofuranosides
Cellular LocationCytoplasmic
SMPDB Pathways
Fructose MetabolismPW002390 ThumbThumb?image type=greyscaleThumb?image type=simple
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Galactose metabolismec00052 Map00052
Starch and sucrose metabolismec00500 Map00500
SMPDB Reactions
sucrose-6-phosphate + waterD-Fructose + Beta-D-Glucose 6-phosphate
Sucrose + waterD-Fructose + Alpha-D-Glucose
sucrose-6-phosphate + waterD-Fructose + Glucose 6-phosphate
KEGG Reactions
water + Sucrose D-Fructose + D-Glucose
Metabolites
YMDB IDNameView
YMDB00273Alpha-D-GlucoseShow
YMDB00286D-GlucoseShow
YMDB00311Beta-D-Glucose 6-phosphateShow
YMDB00657D-FructoseShow
YMDB00890waterShow
YMDB00906SucroseShow
YMDB00947Glucose 6-phosphateShow
YMDB16265sucrose-6-phosphateShow
GO Classification
Component
Not Available
Function
hydrolase activity
hydrolase activity, acting on glycosyl bonds
hydrolase activity, hydrolyzing O-glycosyl compounds
catalytic activity
Process
primary metabolic process
carbohydrate metabolic process
metabolic process
Gene Properties
Chromosome Locationchromosome 9
LocusYIL162W
Gene Sequence>1599 bp ATGCTTTTGCAAGCTTTCCTTTTCCTTTTGGCTGGTTTTGCAGCCAAAATATCTGCATCA ATGACAAACGAAACTAGCGATAGACCTTTGGTCCACTTCACACCCAACAAGGGCTGGATG AATGACCCAAATGGGTTGTGGTACGATGAAAAAGATGCCAAATGGCATCTGTACTTTCAA TACAACCCAAATGACACCGTATGGGGTACGCCATTGTTTTGGGGCCATGCTACTTCCGAT GATTTGACTAATTGGGAAGATCAACCCATTGCTATCGCTCCCAAGCGTAACGATTCAGGT GCTTTCTCTGGCTCCATGGTGGTTGATTACAACAACACGAGTGGGTTTTTCAATGATACT ATTGATCCAAGACAAAGATGCGTTGCGATTTGGACTTATAACACTCCTGAAAGTGAAGAG CAATACATTAGCTATTCTCTTGATGGTGGTTACACTTTTACTGAATACCAAAAGAACCCT GTTTTAGCTGCCAACTCCACTCAATTCAGAGATCCAAAGGTGTTCTGGTATGAACCTTCT CAAAAATGGATTATGACGGCTGCCAAATCACAAGACTACAAAATTGAAATTTACTCCTCT GATGACTTGAAGTCCTGGAAGCTAGAATCTGCATTTGCCAACGAAGGTTTCTTAGGCTAC CAATACGAATGTCCAGGTTTGATTGAAGTCCCAACTGAGCAAGATCCTTCCAAATCTTAT TGGGTCATGTTTATTTCTATCAACCCAGGTGCACCTGCTGGCGGTTCCTTCAACCAATAT TTTGTTGGATCCTTCAATGGTACTCATTTTGAAGCGTTTGACAATCAATCTAGAGTGGTA GATTTTGGTAAGGACTACTATGCCTTGCAAACTTTCTTCAACACTGACCCAACCTACGGT TCAGCATTAGGTATTGCCTGGGCTTCAAACTGGGAGTACAGTGCCTTTGTCCCAACTAAC CCATGGAGATCATCCATGTCTTTGGTCCGCAAGTTTTCTTTGAACACTGAATATCAAGCT AATCCAGAGACTGAATTGATCAATTTGAAAGCCGAACCAATATTGAACATTAGTAATGCT GGTCCCTGGTCTCGTTTTGCTACTAACACAACTCTAACTAAGGCCAATTCTTACAATGTC GATTTGAGCAACTCGACTGGTACCCTAGAGTTTGAGTTGGTTTACGCTGTTAACACCACA CAAACCATATCCAAATCCGTCTTTGCCGACTTATCACTTTGGTTCAAGGGTTTAGAAGAT CCTGAAGAATATTTGAGAATGGGTTTTGAAGTCAGTGCTTCTTCCTTCTTTTTGGACCGT GGTAACTCTAAGGTCAAGTTTGTCAAGGAGAACCCATATTTCACAAACAGAATGTCTGTC AACAACCAACCATTCAAGTCTGAGAACGACCTAAGTTACTATAAAGTGTACGGCCTACTG GATCAAAACATCTTGGAATTGTACTTCAACGATGGAGATGTGGTTTCTACAAATACCTAC TTCATGACCACCGGTAACGCTCTAGGATCTGTGAACATGACCACTGGTGTCGATAATTTG TTCTACATTGACAAGTTCCAAGTAAGGGAAGTAAAATAG
Protein Properties
Pfam Domain Function
Protein Residues532
Protein Molecular Weight60638.89844
Protein Theoretical pI4.36
Signalling Regions
  • 1-19
Transmembrane Regions
  • None
Protein Sequence>Invertase 2 MLLQAFLFLLAGFAAKISASMTNETSDRPLVHFTPNKGWMNDPNGLWYDEKDAKWHLYFQ YNPNDTVWGTPLFWGHATSDDLTNWEDQPIAIAPKRNDSGAFSGSMVVDYNNTSGFFNDT IDPRQRCVAIWTYNTPESEEQYISYSLDGGYTFTEYQKNPVLAANSTQFRDPKVFWYEPS QKWIMTAAKSQDYKIEIYSSDDLKSWKLESAFANEGFLGYQYECPGLIEVPTEQDPSKSY WVMFISINPGAPAGGSFNQYFVGSFNGTHFEAFDNQSRVVDFGKDYYALQTFFNTDPTYG SALGIAWASNWEYSAFVPTNPWRSSMSLVRKFSLNTEYQANPETELINLKAEPILNISNA GPWSRFATNTTLTKANSYNVDLSNSTGTLEFELVYAVNTTQTISKSVFADLSLWFKGLED PEEYLRMGFEVSASSFFLDRGNSKVKFVKENPYFTNRMSVNNQPFKSENDLSYYKVYGLL DQNILELYFNDGDVVSTNTYFMTTGNALGSVNMTTGVDNLFYIDKFQVREVK
References
External Links
ResourceLink
Saccharomyces Genome Database SUC2
Uniprot IDP00724
Uniprot NameINV2_YEAST
GenBank Gene IDV01311
Genebank Protein ID3834
General Reference
  • Taussig, R., Carlson, M. (1983). "Nucleotide sequence of the yeast SUC2 gene for invertase." Nucleic Acids Res 11:1943-1954.6300785
  • Churcher, C., Bowman, S., Badcock, K., Bankier, A., Brown, D., Chillingworth, T., Connor, R., Devlin, K., Gentles, S., Hamlin, N., Harris, D., Horsnell, T., Hunt, S., Jagels, K., Jones, M., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Rowley, N., Skelton, J., Smith, V., Barrell, B., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IX." Nature 387:84-87.9169870
  • Xie, K. W., Feng, B., Li, Y. Y. (1991). "[The effects of upstream region of SUC2 gene on its expression]." Yi Chuan Xue Bao 18:175-184.1888528
  • Carlson, M., Taussig, R., Kustu, S., Botstein, D. (1983). "The secreted form of invertase in Saccharomyces cerevisiae is synthesized from mRNA encoding a signal sequence." Mol Cell Biol 3:439-447.6341817
  • Sarokin, L., Carlson, M. (1984). "Upstream region required for regulated expression of the glucose-repressible SUC2 gene of Saccharomyces cerevisiae." Mol Cell Biol 4:2750-2757.6396505
  • Kaiser, C. A., Botstein, D. (1986). "Secretion-defective mutations in the signal sequence for Saccharomyces cerevisiae invertase." Mol Cell Biol 6:2382-2391.3537718
  • Reddy, V. A., Maley, F. (1990). "Identification of an active-site residue in yeast invertase by affinity labeling and site-directed mutagenesis." J Biol Chem 265:10817-10820.2113524
  • Reddy, V. A., Johnson, R. S., Biemann, K., Williams, R. S., Ziegler, F. D., Trimble, R. B., Maley, F. (1988). "Characterization of the glycosylation sites in yeast external invertase. I. N-linked oligosaccharide content of the individual sequons." J Biol Chem 263:6978-6985.3284881
  • Carlson, M., Botstein, D. (1982). "Two differentially regulated mRNAs with different 5' ends encode secreted with intracellular forms of yeast invertase." Cell 28:145-154.7039847
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106