You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhosphoglycerate kinase
SynonymsNot Available
Gene NamePGK1
Enzyme Class
Biological Properties
General FunctionInvolved in phosphoglycerate kinase activity
Specific FunctionATP + 3-phospho-D-glycerate = ADP + 3-phospho- D-glyceroyl phosphate
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG Pathways
Glycolysis / Gluconeogenesisec00010 Map00010
SMPDB Reactions
Glyceric acid 1,3-biphosphate + ADP3-Phosphoglyceric acid + Adenosine triphosphate
KEGG Reactions
Adenosine triphosphate + 3-phospho-D-glyceric acid3-phospho-D-glyceroyl dihydrogen phosphate + ADP
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00270Glyceric acid 1,3-biphosphateShow
YMDB003413-Phosphoglyceric acidShow
YMDB006723-phospho-D-glyceroyl dihydrogen phosphateShow
YMDB007563-phospho-D-glyceric acidShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
phosphoglycerate kinase activity
Process
metabolic process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
glucose metabolic process
glucose catabolic process
glycolysis
Gene Properties
Chromosome Locationchromosome 3
LocusYCR012W
Gene Sequence>1251 bp ATGTCTTTATCTTCAAAGTTGTCTGTCCAAGATTTGGACTTGAAGGACAAGCGTGTCTTC ATCAGAGTTGACTTCAACGTCCCATTGGACGGTAAGAAGATCACTTCTAACCAAAGAATT GTTGCTGCTTTGCCAACCATCAAGTACGTTTTGGAACACCACCCAAGATACGTTGTCTTG GCTTCTCACTTGGGTAGACCAAACGGTGAAAGAAACGAAAAATACTCTTTGGCTCCAGTT GCTAAGGAATTGCAATCATTGTTGGGTAAGGATGTCACCTTCTTGAACGACTGTGTCGGT CCAGAAGTTGAAGCCGCTGTCAAGGCTTCTGCCCCAGGTTCCGTTATTTTGTTGGAAAAC TTGCGTTACCACATCGAAGAAGAAGGTTCCAGAAAGGTCGATGGTCAAAAGGTCAAGGCT TCCAAGGAAGATGTTCAAAAGTTCAGACACGAATTGAGCTCTTTGGCTGATGTTTACATC AACGATGCCTTCGGTACCGCTCACAGAGCTCACTCTTCTATGGTCGGTTTCGACTTGCCA CAACGTGCTGCCGGTTTCTTGTTGGAAAAGGAATTGAAGTACTTCGGTAAGGCTTTGGAG AACCCAACCAGACCATTCTTGGCCATCTTAGGTGGTGCCAAGGTTGCTGACAAGATTCAA TTGATTGACAACTTGTTGGACAAGGTCGACTCTATCATCATTGGTGGTGGTATGGCTTTC ACCTTCAAGAAGGTTTTGGAAAACACTGAAATCGGTGACTCCATCTTCGACAAGGCTGGT GCTGAAATCGTTCCAAAGTTGATGGAAAAGGCCAAGGCCAAGGGTGTCGAAGTCGTCTTG CCAGTCGACTTCATCATTGCTGATGCTTTCTCTGCTGATGCCAACACCAAGACTGTCACT GACAAGGAAGGTATTCCAGCTGGCTGGCAAGGGTTGGACAATGGTCCAGAATCTAGAAAG TTGTTTGCTGCTACTGTTGCAAAGGCTAAGACCATTGTCTGGAACGGTCCACCAGGTGTT TTCGAATTCGAAAAGTTCGCTGCTGGTACTAAGGCTTTGTTAGACGAAGTTGTCAAGAGC TCTGCTGCTGGTAACACCGTCATCATTGGTGGTGGTGACACTGCCACTGTCGCTAAGAAG TACGGTGTCACTGACAAGATCTCCCATGTCTCTACTGGTGGTGGTGCTTCTTTGGAATTA TTGGAAGGTAAGGAATTGCCAGGTGTTGCTTTCTTATCCGAAAAGAAATAA
Protein Properties
Pfam Domain Function
Protein Residues416
Protein Molecular Weight44738.0
Protein Theoretical pI7.8
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Phosphoglycerate kinase MSLSSKLSVQDLDLKDKRVFIRVDFNVPLDGKKITSNQRIVAALPTIKYVLEHHPRYVVL ASHLGRPNGERNEKYSLAPVAKELQSLLGKDVTFLNDCVGPEVEAAVKASAPGSVILLEN LRYHIEEEGSRKVDGQKVKASKEDVQKFRHELSSLADVYINDAFGTAHRAHSSMVGFDLP QRAAGFLLEKELKYFGKALENPTRPFLAILGGAKVADKIQLIDNLLDKVDSIIIGGGMAF TFKKVLENTEIGDSIFDKAGAEIVPKLMEKAKAKGVEVVLPVDFIIADAFSADANTKTVT DKEGIPAGWQGLDNGPESRKLFAATVAKAKTIVWNGPPGVFEFEKFAAGTKALLDEVVKS SAAGNTVIIGGGDTATVAKKYGVTDKISHVSTGGGASLELLEGKELPGVAFLSEKK
References
External Links
ResourceLink
Saccharomyces Genome Database PGK1
Uniprot IDP00560
Uniprot NamePGK_YEAST
GenBank Gene IDJ01342
Genebank Protein ID1197055
PDB ID
1QPG
General Reference
  • Hitzeman, R. A., Hagie, F. E., Hayflick, J. S., Chen, C. Y., Seeburg, P. H., Derynck, R. (1982). "The primary structure of the Saccharomyces cerevisiae gene for 3-phosphoglycerate kinase." Nucleic Acids Res 10:7791-7808.6296791
  • Skala, J., Purnelle, B., Goffeau, A. (1992). "The complete sequence of a 10.8 kb segment distal of SUF2 on the right arm of chromosome III from Saccharomyces cerevisiae reveals seven open reading frames including the RVS161, ADP1 and PGK genes." Yeast 8:409-417.1626432
  • Oliver, S. G., van der Aart, Q. J., Agostoni-Carbone, M. L., Aigle, M., Alberghina, L., Alexandraki, D., Antoine, G., Anwar, R., Ballesta, J. P., Benit, P., et, a. l. .. (1992). "The complete DNA sequence of yeast chromosome III." Nature 357:38-46.1574125
  • Fattoum, A., Roustan, C., Karoui, D., Feinberg, J., Pradel, L. A., Gregoire, J., Rochat, H. (1981). "Structural studies on yeast 3-phosphoglycerate kinase. Linear arrangement of the CNBr fragments, partial amino acid sequence of the inner part of the polypeptide chain, and analyses of the N-terminal domain of the protein." Int J Pept Protein Res 17:393-400.7287307
  • Perkins, R. E., Conroy, S. C., Dunbar, B., Fothergill, L. A., Tuite, M. F., Dobson, M. J., Kingsman, S. M., Kingsman, A. J. (1983). "The complete amino acid sequence of yeast phosphoglycerate kinase." Biochem J 211:199-218.6347186
  • Dobson, M. J., Tuite, M. F., Roberts, N. A., Kingsman, A. J., Kingsman, S. M., Perkins, R. E., Conroy, S. C., Fothergill, L. A. (1982). "Conservation of high efficiency promoter sequences in Saccharomyces cerevisiae." Nucleic Acids Res 10:2625-2637.6281737
  • Norbeck, J., Blomberg, A. (1997). "Two-dimensional electrophoretic separation of yeast proteins using a non-linear wide range (pH 3-10) immobilized pH gradient in the first dimension; reproducibility and evidence for isoelectric focusing of alkaline (pI > 7) proteins." Yeast 13:1519-1534.9509572
  • Walker, P. A., Joao, H. C., Littlechild, J. A., Williams, R. J., Watson, H. C. (1992). "Characterisation of yeast phosphoglycerate kinase modified by mutagenesis at residue 21." Eur J Biochem 207:29-37.1628654
  • Grandier-Vazeille, X., Bathany, K., Chaignepain, S., Camougrand, N., Manon, S., Schmitter, J. M. (2001). "Yeast mitochondrial dehydrogenases are associated in a supramolecular complex." Biochemistry 40:9758-9769.11502169
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Watson, H. C., Walker, N. P., Shaw, P. J., Bryant, T. N., Wendell, P. L., Fothergill, L. A., Perkins, R. E., Conroy, S. C., Dobson, M. J., Tuite, M. F., et, a. l. .. (1982). "Sequence and structure of yeast phosphoglycerate kinase." EMBO J 1:1635-1640.6765200
  • McPhillips, T. M., Hsu, B. T., Sherman, M. A., Mas, M. T., Rees, D. C. (1996). "Structure of the R65Q mutant of yeast 3-phosphoglycerate kinase complexed with Mg-AMP-PNP and 3-phospho-D-glycerate." Biochemistry 35:4118-4127.8672447