You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlyceraldehyde-3-phosphate dehydrogenase 2
Synonyms
  • GAPDH 2
Gene NameTDH2
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
Specific FunctionD-glyceraldehyde 3-phosphate + phosphate + NAD(+) = 3-phospho-D-glyceroyl phosphate + NADH
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG Pathways
Glycolysis / Gluconeogenesisec00010 Map00010
SMPDB ReactionsNot Available
KEGG Reactions
NAD + D-Glyceraldehyde 3-phosphate + phosphateNADH + 3-phospho-D-glyceroyl dihydrogen phosphate + hydron
Metabolites
YMDB IDNameView
YMDB00110NADShow
YMDB00115D-Glyceraldehyde 3-phosphateShow
YMDB00143NADHShow
YMDB00270Glyceric acid 1,3-biphosphateShow
YMDB00412NAD(+)Show
YMDB006723-phospho-D-glyceroyl dihydrogen phosphateShow
YMDB00862hydronShow
YMDB00907phosphateShow
GO Classification
Component
Not Available
Function
catalytic activity
NAD or NADH binding
oxidoreductase activity, acting on the aldehyde or oxo group of donors
oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
binding
nucleotide binding
glyceraldehyde-3-phosphate dehydrogenase activity
oxidoreductase activity
Process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
metabolic process
glucose metabolic process
oxidation reduction
small molecule metabolic process
Gene Properties
Chromosome Locationchromosome 10
LocusYJR009C
Gene Sequence>999 bp ATGGTTAGAGTTGCTATTAACGGTTTCGGTAGAATCGGTAGATTGGTTATGAGAATTGCT TTGCAAAGAAAGAACGTCGAAGTTGTTGCTTTGAACGATCCTTTCATCTCTAACGACTAC TCCGCTTACATGTTCAAGTACGACTCTACTCACGGTAGATACGCTGGTGAAGTTTCCCAC GATGACAAGCACATCATCGTTGATGGTCACAAGATCGCCACTTTCCAAGAAAGAGACCCA GCTAACTTGCCATGGGCTTCTCTAAACATTGACATCGCCATTGACTCCACTGGTGTTTTC AAGGAATTGGACACTGCTCAAAAGCACATTGACGCTGGTGCCAAGAAGGTTGTCATCACT GCTCCATCTTCCACCGCCCCAATGTTCGTCATGGGTGTTAACGAAGAAAAATACACTTCT GACTTGAAGATTGTTTCCAACGCTTCTTGTACCACCAACTGTTTGGCTCCATTGGCCAAG GTTATCAACGATGCTTTCGGTATTGAAGAAGGTTTGATGACCACTGTTCACTCCATGACC GCCACCCAAAAGACTGTTGACGGTCCATCCCACAAGGACTGGAGAGGTGGTAGAACCGCT TCCGGTAACATCATCCCATCCTCTACCGGTGCTGCTAAGGCTGTCGGTAAGGTCTTGCCA GAATTGCAAGGTAAGTTGACCGGTATGGCTTTCAGAGTCCCAACCGTCGATGTTTCCGTT GTTGACTTGACTGTCAAGTTGAACAAGGAAACCACCTACGATGAAATCAAGAAGGTTGTC AAGGCTGCCGCTGAAGGTAAGTTGAAGGGTGTCTTGGGTTACACTGAAGACGCTGTTGTC TCCTCTGACTTCTTGGGTGACTCTAACTCTTCCATCTTCGATGCTGCCGCTGGTATCCAA TTGTCTCCAAAGTTCGTCAAGTTGGTTTCCTGGTACGACAACGAATACGGTTACTCTACC AGAGTTGTCGACTTGGTTGAACACGTTGCCAAGGCTTAA
Protein Properties
Pfam Domain Function
Protein Residues332
Protein Molecular Weight35846.60156
Protein Theoretical pI6.96
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glyceraldehyde-3-phosphate dehydrogenase 2 MVRVAINGFGRIGRLVMRIALQRKNVEVVALNDPFISNDYSAYMFKYDSTHGRYAGEVSH DDKHIIVDGHKIATFQERDPANLPWASLNIDIAIDSTGVFKELDTAQKHIDAGAKKVVIT APSSTAPMFVMGVNEEKYTSDLKIVSNASCTTNCLAPLAKVINDAFGIEEGLMTTVHSMT ATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGKVLPELQGKLTGMAFRVPTVDVSV VDLTVKLNKETTYDEIKKVVKAAAEGKLKGVLGYTEDAVVSSDFLGDSNSSIFDAAAGIQ LSPKFVKLVSWYDNEYGYSTRVVDLVEHVAKA
References
External Links
ResourceLink
Saccharomyces Genome Database TDH2
Uniprot IDP00358
Uniprot NameG3P2_YEAST
GenBank Gene IDX60157
Genebank Protein ID3936
General Reference
  • Mountain, H. A., Korch, C. (1991). "TDH2 is linked to MET3 on chromosome X of Saccharomyces cerevisiae." Yeast 7:873-880.1789010
  • Holland, J. P., Holland, M. J. (1980). "Structural comparison of two nontandemly repeated yeast glyceraldehyde-3-phosphate dehydrogenase genes." J Biol Chem 255:2596-2605.6244283
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Norbeck, J., Blomberg, A. (1995). "Gene linkage of two-dimensional polyacrylamide gel electrophoresis resolved proteins from isogene families in Saccharomyces cerevisiae by microsequencing of in-gel trypsin generated peptides." Electrophoresis 16:149-156.7737086
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358