Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePutative glucosamine--fructose-6-phosphate aminotransferase [isomerizing]
Synonyms
  • GFAT
  • D-fructose-6-phosphate amidotransferase
  • Hexosephosphate aminotransferase
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionInvolved in metabolic process
Specific FunctionInvolved in amino sugar synthesis (formation of chitin, supplies the amino sugars of asparagine-linked oligosaccharides of glycoproteins)
Cellular LocationNot Available
SMPDB Pathways
Amino sugar and nucleotide sugar metabolismPW002413 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Alanine, aspartate and glutamate metabolismec00250 Map00250
Amino sugar and nucleotide sugar metabolismec00520 Map00520
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00002L-GlutamineShow
YMDB00044Glucosamine 6-phosphateShow
YMDB00078Fructose 6-phosphateShow
YMDB00271L-Glutamic acidShow
GO Classification
Component
Not Available
Function
Not Available
Process
metabolic process
Gene Properties
Chromosome LocationNot Available
LocusYMR084W
Gene Sequence>789 bp ATGTGTGGCATTTTTGGCTATTGCAATTTTTTAATTGAGAAGACAAGAGGAGAAATCATC GACACTTTAATCGAAGGGTTACAGGCATTGGAGTACAAGGAATATGACTCCAGTGGAATT TCGATCCAAGGTGATGAGCTGGAGTCTCTCAATATTTATAAGCAAACCGGTAAAATAAGC AGTTTGAAGGAAGAAATCGACCTTTACAATCTTAATAAGAACCTGCCCTTTATTTCGCAT TGTGGCATTGCCCATACTAGGCGGGCAACACATGGAGGGCTAAGACGTGCAAATTGTCAT CCACATAACTCAGATCCATCTAATGAATTTGTTGTGGTACACAACGGGGTTATTACCAAC TTCGCTAATTTGAAAGCCTTATTGATGGCAAAGGGCTATGTGTTCAAAAGTGACACTGAT ACCGAATGTATTCCTAAACTGTACAAACACATTTATGATACAAGCATTGAACTCGGGTAC AACCTCGATTTCCATGTATTAACAAATTTAGTACTTAAAGAATTGGAAGGCTCTTATGGT CTGCTATGCACTTCTTCTCATTTTCCCGATGAAGTGGTTGCCGCAAGAAAGGGTTCCCCG TTAGTTATTGGTGTTAAAGGTAAAACTGACATGGACGTAAACTTTGTCGAGGTGGAATAT TTGGATCAAGAAGAAGACTACTTGAAGCTTAATACTCAAACCAAGAGTTCTGGTAATGTC TTGGCTGCCGCACCTGTAAAATATAACACTTGTTTAAGGAAGTCACCCCCCTTCGTTCAC AATACCTGA
Protein Properties
Pfam Domain Function
Protein Residues262
Protein Molecular Weight29272.0
Protein Theoretical pI6.17
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Putative glucosamine--fructose-6-phosphate aminotransferase [isomerizing] MCGIFGYCNFLIEKTRGEIIDTLIEGLQALEYKEYDSSGISIQGDELESLNIYKQTGKIS SLKEEIDLYNLNKNLPFISHCGIAHTRRATHGGLRRANCHPHNSDPSNEFVVVHNGVITN FANLKALLMAKGYVFKSDTDTECIPKLYKHIYDTSIELGYNLDFHVLTNLVLKELEGSYG LLCTSSHFPDEVVAARKGSPLVIGVKGKTDMDVNFVEVEYLDQEEDYLKLNTQTKSSGNV LAAAPVKYNTCLRKSPPFVHNT
References
External Links
ResourceLink
Saccharomyces Genome Database YMR084W
Uniprot IDA2P2R3
Uniprot NameYM084_YEAST
GenBank Gene IDAY692572
Genebank Protein ID51012595
General Reference
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Brachat, S., Dietrich, F. S., Voegeli, S., Zhang, Z., Stuart, L., Lerch, A., Gates, K., Gaffney, T., Philippsen, P. (2003). "Reinvestigation of the Saccharomyces cerevisiae genome annotation by comparison to the genome of a related fungus: Ashbya gossypii." Genome Biol 4:R45.12844361