Identification
NameATPase GET3
Synonyms
  • Arsenical pump-driving ATPase
  • Arsenite-stimulated ATPase
  • Golgi to ER traffic protein 3
  • Guided entry of tail-anchored proteins 3
Gene NameGET3
Enzyme Class
Biological Properties
General FunctionInorganic ion transport and metabolism
Specific FunctionATPase required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol. This complex then targets to the endoplasmic reticulum by membrane-bound receptors GET1 and GET2, where the tail-anchored protein is released for insertion. This process is regulated by ATP binding and hydrolysis. ATP binding drives the homodimer towards the closed dimer state, facilitating recognition of newly synthesized TA membrane proteins. ATP hydolysis is required for insertion. Subsequently, the homodimer reverts towards the open dimer state, lowering its affinity for the GET1-GET2 receptor, and returning it to the cytosol to initiate a new round of targeting. Cooperates with the HDEL receptor ERD2 to mediate the ATP-dependent retrieval of resident ER proteins that contain a C-terminal H-D-E-L retention signal from the Golgi to the ER. Involved in low-level resistance to the oxyanions arsenite and arsenate, and in heat tolerance
Cellular LocationCytoplasm. Endoplasmic reticulum. Golgi apparatus.
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
water + 7,8-dihydroneopterin 3'-phosphate → phosphate + 7,8-Dihydroneopterin
Metabolites
YMDB IDNameView
YMDB005797,8-DihydroneopterinShow
YMDB006687,8-dihydroneopterin 3'-phosphateShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
Process
biological regulation
regulation of biological quality
homeostatic process
chemical homeostasis
ion homeostasis
cellular ion homeostasis
cellular cation homeostasis
cellular metal ion homeostasis
Gene Properties
Chromosome Locationchromosome 4
LocusYDL100C
Gene Sequence>1065 bp ATGGATTTAACCGTGGAACCTAATTTGCACTCTTTAATTACCTCTACCACTCATAAGTGG ATTTTCGTTGGTGGTAAAGGTGGTGTTGGTAAGACTACTTCATCATGTTCCATTGCTATC CAAATGACTTTGAGTCAACCAAACAAACAGTTCCTACTGATCTCTACTGATCCTGCCCAT AACTTAAGTGATGCATTCGGTGAGAAATTTGGTAAAGACGCCAGAAAGGTGACAGGCATG AATAATCTATCATGTATGGAAATCGATCCATCCGCTGCTTTGAAGGATATGAACGACATG GCAGTTTCACGCGCTAACAATAACGGAAGTGACGGTCAAGGTGACGATCTAGGAAGCTTG CTTCAAGGTGGTGCTCTTGCTGATTTGACCGGTTCCATCCCTGGTATCGACGAAGCTTTA TCCTTCATGGAAGTCATGAAGCACATTAAAAGGCAAGAACAGGGCGAAGGTGAAACCTTC GATACTGTTATTTTTGACACTGCTCCAACTGGCCACACATTAAGATTTCTACAACTACCA AATACTTTATCCAAGCTTTTGGAAAAGTTCGGTGAAATTACCAACAAATTGGGCCCAATG CTAAACTCTTTTATGGGCGCAGGTAATGTCGATATCTCTGGAAAATTGAACGAGTTAAAG GCTAATGTCGAGACCATCAGACAACAATTCACGGATCCTGACCTAACGACTTTTGTTTGC GTTTGTATCAGTGAATTCTTATCCTTATATGAAACTGAAAGACTAATTCAGGAATTGATT TCCTACGATATGGACGTTAATTCCATCATTGTCAACCAATTATTATTTGCTGAAAACGAT CAAGAGCACAACTGTAAGAGATGTCAGGCAAGATGGAAGATGCAAAAGAAGTACTTGGAC CAAATCGACGAATTGTACGAAGATTTCCATGTCGTTAAAATGCCATTATGTGCTGGAGAA ATCAGAGGCTTAAATAACTTAACAAAGTTCTCACAGTTCCTAAACAAAGAATATAACCCT ATTACTGATGGCAAAGTCATTTATGAGTTAGAAGATAAGGAATAG
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues354
Protein Molecular Weight39353.39844
Protein Theoretical pI4.61
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>ATPase GET3 MDLTVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAH NLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSRANNNGSDGQGDDLGSL LQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLP NTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVC VCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLD QIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELEDKE
References
External Links
ResourceLink
Saccharomyces Genome Database GET3
Uniprot IDQ12154
Uniprot NameGET3_YEAST
GenBank Gene IDAY693164
Genebank Protein ID51013779
General Reference
  • Boskovic, J., Soler-Mira, A., Garcia-Cantalejo, J. M., Ballesta, J. P., Jimenez, A., Remacha, M. (1996). "The sequence of a 16,691 bp segment of Saccharomyces cerevisiae chromosome IV identifies the DUN1, PMT1, PMT5, SRP14 and DPR1 genes, and five new open reading frames." Yeast 12:1377-1384.8923743
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ho, Y., Gruhler, A., Heilbut, A., Bader, G. D., Moore, L., Adams, S. L., Millar, A., Taylor, P., Bennett, K., Boutilier, K., Yang, L., Wolting, C., Donaldson, I., Schandorff, S., Shewnarane, J., Vo, M., Taggart, J., Goudreault, M., Muskat, B., Alfarano, C., Dewar, D., Lin, Z., Michalickova, K., Willems, A. R., Sassi, H., Nielsen, P. A., Rasmussen, K. J., Andersen, J. R., Johansen, L. E., Hansen, L. H., Jespersen, H., Podtelejnikov, A., Nielsen, E., Crawford, J., Poulsen, V., Sorensen, B. D., Matthiesen, J., Hendrickson, R. C., Gleeson, F., Pawson, T., Moran, M. F., Durocher, D., Mann, M., Hogue, C. W., Figeys, D., Tyers, M. (2002). "Systematic identification of protein complexes in Saccharomyces cerevisiae by mass spectrometry." Nature 415:180-183.11805837
  • Shen, J., Hsu, C. M., Kang, B. K., Rosen, B. P., Bhattacharjee, H. (2003). "The Saccharomyces cerevisiae Arr4p is involved in metal and heat tolerance." Biometals 16:369-378.12680698
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Schuldiner, M., Collins, S. R., Thompson, N. J., Denic, V., Bhamidipati, A., Punna, T., Ihmels, J., Andrews, B., Boone, C., Greenblatt, J. F., Weissman, J. S., Krogan, N. J. (2005). "Exploration of the function and organization of the yeast early secretory pathway through an epistatic miniarray profile." Cell 123:507-519.16269340
  • Auld, K. L., Hitchcock, A. L., Doherty, H. K., Frietze, S., Huang, L. S., Silver, P. A. (2006). "The conserved ATPase Get3/Arr4 modulates the activity of membrane-associated proteins in Saccharomyces cerevisiae." Genetics 174:215-227.16816426
  • Metz, J., Wachter, A., Schmidt, B., Bujnicki, J. M., Schwappach, B. (2006). "The yeast Arr4p ATPase binds the chloride transporter Gef1p when copper is available in the cytosol." J Biol Chem 281:410-417.16260785
  • Schuldiner, M., Metz, J., Schmid, V., Denic, V., Rakwalska, M., Schmitt, H. D., Schwappach, B., Weissman, J. S. (2008). "The GET complex mediates insertion of tail-anchored proteins into the ER membrane." Cell 134:634-645.18724936
  • Mateja, A., Szlachcic, A., Downing, M. E., Dobosz, M., Mariappan, M., Hegde, R. S., Keenan, R. J. (2009). "The structural basis of tail-anchored membrane protein recognition by Get3." Nature 461:361-366.19675567
  • Suloway, C. J., Chartron, J. W., Zaslaver, M., Clemons, W. M. Jr (2009). "Model for eukaryotic tail-anchored protein binding based on the structure of Get3." Proc Natl Acad Sci U S A 106:14849-14854.19706470