| Identification |
|---|
| Name | Phosphorelay intermediate protein YPD1 |
|---|
| Synonyms | - Histidine-containing phosphotransfer protein YPD1
- Tyrosine phosphatase-dependent protein 1
|
|---|
| Gene Name | YPD1 |
|---|
| Enzyme Class | Not Available |
|---|
| Biological Properties |
|---|
| General Function | phosphorylation |
|---|
| Specific Function | Phosphorelay intermediate protein that is part of the branched SLN1-YPD1-SKN7/SSK1 two-component regulatory system, which controls activity of the HOG1 pathway and gene expression in response to changes in the osmolarity of the extracellular environment. Catalyzes the phosphoryl group transfer from the membrane-bound osmosensing histidine kinase SLN1 to two distinct response regulator proteins, SSK1 in the cytoplasm, and transcription factor SKN7 in the nucleus. |
|---|
| Cellular Location | Not Available |
|---|
| SMPDB Pathways | | Stress-activated signalling pathways: high osmolarity | PW002516 |    | | Stress-activated signalling pathways: high osmolarity 1469654356 | PW002970 |    | | Stress-activated signalling pathways: high osmolarity test 1 | PW002773 |    | | Stress-activated signalling pathways: low osmolarity | PW002515 |    |
|
|---|
| KEGG Pathways | Not Available |
|---|
| SMPDB Reactions | Not Available |
|---|
| KEGG Reactions | Not Available |
|---|
| Metabolites | |
|---|
| GO Classification | | Function |
|---|
| transferase activity, transferring phosphorus-containing groups | | nucleus | | cytoplasm | | histidine phosphotransfer kinase activity | | osmosensory signaling via phosphorelay pathway | | protein histidine kinase binding | | phosphorylation |
|
|---|
| Gene Properties |
|---|
| Chromosome Location | Not Available |
|---|
| Locus | |
|---|
| Gene Sequence | >504 bp
ATGTCTACTATTCCCTCAGAAATCATCAATTGGACCATCTTAAATGAAATTATATCTATG
GATGACGATGATTCCGATTTTTCTAAAGGTCTAATTATTCAATTTATCGACCAGGCACAA
ACAACTTTTGCTCAAATGCAACGACAGCTGGACGGTGAAAAAAATCTTACCGAATTAGAC
AATCTGGGCCATTTTTTAAAGGGTTCTTCTGCTGCATTAGGCTTACAAAGAATTGCCTGG
GTTTGTGAAAGAATTCAAAACTTGGGAAGAAAAATGGAACATTTCTTCCCCAACAAGACC
GAATTGGTCAACACTCTGAGCGATAAATCGATTATTAATGGAATCAATATTGATGAAGAT
GACGAGGAAATAAAGATACAAGTGGACGATAAAGACGAAAATTCCATATATCTCATCTTG
ATAGCAAAAGCTTTGAACCAGTCTAGGTTGGAGTTCAAACTGGCGAGAATTGAGTTATCT
AAATATTACAACACAAACCTATAA |
|---|
| Protein Properties |
|---|
| Pfam Domain Function | Not Available |
|---|
| Protein Residues | 167 |
|---|
| Protein Molecular Weight | 19168.48 |
|---|
| Protein Theoretical pI | Not Available |
|---|
| PDB File | show |
|---|
| Signalling Regions | Not Available |
|---|
| Transmembrane Regions | Not Available |
|---|
| Protein Sequence | >Phosphorelay intermediate protein YPD1
MSTIPSEIINWTILNEIISMDDDDSDFSKGLIIQFIDQAQTTFAQMQRQLDGEKNLTELD
NLGHFLKGSSAALGLQRIAWVCERIQNLGRKMEHFFPNKTELVNTLSDKSIINGINIDED
DEEIKIQVDDKDENSIYLILIAKALNQSRLEFKLARIELSKYYNTNL |
|---|
| References |
|---|
| External Links | | Resource | Link |
|---|
| Saccharomyces Genome Database | YPD1 | | Uniprot ID | Q07688 | | Uniprot Name | YPD1 | | PDB ID | 1C02 |
|
|---|
| General Reference | Not Available |
|---|