| Identification |
|---|
| Name | V-type proton ATPase subunit G |
|---|
| Synonyms | - V-ATPase subunit G
- V-ATPase 13 kDa subunit
- Vacuolar proton pump subunit G
|
|---|
| Gene Name | VMA10 |
|---|
| Enzyme Class | Not Available |
|---|
| Biological Properties |
|---|
| General Function | Involved in proton-transporting ATPase activity, rotati |
|---|
| Specific Function | Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells |
|---|
| Cellular Location | Cytoplasmic |
|---|
| SMPDB Pathways | Not Available |
|---|
| KEGG Pathways | Not Available |
|---|
| SMPDB Reactions | Not Available |
|---|
| KEGG Reactions | Not Available |
|---|
| Metabolites | |
|---|
| GO Classification | | Component |
|---|
| macromolecular complex | | protein complex | | proton-transporting two-sector ATPase complex | | proton-transporting V-type ATPase complex | | vacuolar proton-transporting V-type ATPase complex | | Function |
|---|
| hydrolase activity | | hydrolase activity, acting on acid anhydrides | | hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances | | catalytic activity | | Process |
|---|
| hydrogen transport | | proton transport | | establishment of localization | | transport |
|
|---|
| Gene Properties |
|---|
| Chromosome Location | Not Available |
|---|
| Locus | |
|---|
| Gene Sequence | >345 bp
ATGTCCCAAAAAAACGGAATTGCCACCCTACTACAAGCTGAAAAGGAAGCCCACGAAATA
GTATCAAAGGCTAGAAAGTACAGACAAGATAAGTTGAAGCAAGCCAAGACTGATGCAGCC
AAGGAAATCGACTCATACAAAATTCAAAAAGACAAGGAATTGAAGGAGTTTGAACAAAAG
AATGCCGGTGGTGTTGGTGAATTGGAAAAGAAAGCAGAGGCTGGTGTGCAAGGTGAATTA
GCTGAGATTAAGAAAATTGCAGAGAAGAAAAAGGATGACGTTGTCAAAATTTTGATCGAG
ACTGTCATCAAGCCTTCTGCTGAAGTCCATATCAATGCCTTGTAA |
|---|
| Protein Properties |
|---|
| Pfam Domain Function | |
|---|
| Protein Residues | 114 |
|---|
| Protein Molecular Weight | 12712.59961 |
|---|
| Protein Theoretical pI | 9.67 |
|---|
| Signalling Regions | |
|---|
| Transmembrane Regions | |
|---|
| Protein Sequence | >V-type proton ATPase subunit G
MSQKNGIATLLQAEKEAHEIVSKARKYRQDKLKQAKTDAAKEIDSYKIQKDKELKEFEQK
NAGGVGELEKKAEAGVQGELAEIKKIAEKKKDDVVKILIETVIKPSAEVHINAL |
|---|
| References |
|---|
| External Links | |
|---|
| General Reference | - Supekova, L., Supek, F., Nelson, N. (1995). "The Saccharomyces cerevisiae VMA10 is an intron-containing gene encoding a novel 13-kDa subunit of vacuolar H(+)-ATPase." J Biol Chem 270:13726-13732.7775427
- Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
- Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
|
|---|