| Identification |
|---|
| Name | tRNA-splicing endonuclease subunit SEN34 |
|---|
| Synonyms | - Splicing endonuclease of 34 kDa
- tRNA-intron endonuclease SEN34
|
|---|
| Gene Name | SEN34 |
|---|
| Enzyme Class | |
|---|
| Biological Properties |
|---|
| General Function | Involved in nucleic acid binding |
|---|
| Specific Function | Constitutes one of the two catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5'- and 3'-splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. It probably carries the active site for 3'-splice site cleavage |
|---|
| Cellular Location | Nucleus. Endomembrane system; Peripheral membrane protein. Mitochondrion outer membrane; Peripheral membrane protein; Cytoplasmic side. |
|---|
| SMPDB Pathways | Not Available |
|---|
| KEGG Pathways | Not Available |
|---|
| SMPDB Reactions | Not Available |
|---|
| KEGG Reactions | Not Available |
|---|
| Metabolites | | YMDB ID | Name | View |
|---|
| YMDB00890 | water | Show |
|
|---|
| GO Classification | | Component |
|---|
| tRNA-intron endonuclease complex | | macromolecular complex | | protein complex | | Function |
|---|
| catalytic activity | | ribonuclease activity | | tRNA-specific ribonuclease activity | | tRNA-intron endonuclease activity | | binding | | hydrolase activity | | hydrolase activity, acting on ester bonds | | nucleic acid binding | | nuclease activity | | Process |
|---|
| RNA splicing | | RNA splicing, via endonucleolytic cleavage and ligation | | tRNA splicing, via endonucleolytic cleavage and ligation | | metabolic process | | macromolecule metabolic process | | tRNA-type intron splice site recognition and cleavage | | cellular macromolecule metabolic process | | RNA metabolic process | | RNA processing |
|
|---|
| Gene Properties |
|---|
| Chromosome Location | chromosome 1 |
|---|
| Locus | YAR008W |
|---|
| Gene Sequence | >828 bp
ATGCCACCGCTAGTATTTGACATAGATCACATCAAACTTCTAAGGAAATGGGGTATTTGT
GGTGTGTTATCTGGAACTTTGCCTACTGCAGCACAGCAAAATGTATTTTTGTCGGTACCT
TTGAGGCTTATGTTAGAAGATGTGCTGTGGCTGCATTTGAACAATCTTGCCGATGTGAAA
TTAATAAGACAAGAGGGAGATGAGATTATGGAGGGAATAACATTAGAGCGGGGCGCCAAA
CTATCTAAAATTGTCAACGATCGTTTGAACAAGTCATTTGAATATCAGAGAAAGTTCAAA
AAGGATGAACACATTGCAAAATTAAAGAAAATCGGTAGAATCAATGATAAAACCACAGCT
GAAGAATTGCAACGGCTTGATAAATCTAGCAATAATGACCAGCTAATTGAATCTTCTTTG
TTCATTGACATTGCTAATACCTCTATGATTTTAAGAGACATACGGAGTGATTCAGACAGC
TTATCCCGCGATGATATCAGTGATTTGTTATTTAAGCAGTACAGACAGGCAGGAAAAATG
CAGACCTATTTCTTATACAAGGCATTGAGAGATCAAGGGTACGTTTTGTCCCCAGGTGGA
CGTTTTGGTGGGAAGTTTATAGCATACCCTGGTGATCCTCTTCGTTTCCATTCACATCTG
ACGATACAAGATGCGATTGATTATCATAATGAGCCGATTGACCTAATATCCATGATAAGT
GGTGCAAGACTAGGAACGACTGTGAAAAAACTTTGGGTCATAGGCGGTGTTGCGGAAGAG
ACAAAGGAAACTCATTTCTTCTCAATAGAATGGGCTGGATTTGGTTAA |
|---|
| Protein Properties |
|---|
| Pfam Domain Function | |
|---|
| Protein Residues | 275 |
|---|
| Protein Molecular Weight | 31312.69922 |
|---|
| Protein Theoretical pI | 7.79 |
|---|
| Signalling Regions | |
|---|
| Transmembrane Regions | |
|---|
| Protein Sequence | >tRNA-splicing endonuclease subunit SEN34
MPPLVFDIDHIKLLRKWGICGVLSGTLPTAAQQNVFLSVPLRLMLEDVLWLHLNNLADVK
LIRQEGDEIMEGITLERGAKLSKIVNDRLNKSFEYQRKFKKDEHIAKLKKIGRINDKTTA
EELQRLDKSSNNDQLIESSLFIDIANTSMILRDIRSDSDSLSRDDISDLLFKQYRQAGKM
QTYFLYKALRDQGYVLSPGGRFGGKFIAYPGDPLRFHSHLTIQDAIDYHNEPIDLISMIS
GARLGTTVKKLWVIGGVAEETKETHFFSIEWAGFG |
|---|
| References |
|---|
| External Links | |
|---|
| General Reference | - Clark, M. W., Keng, T., Storms, R. K., Zhong, W., Fortin, N., Zeng, B., Delaney, S., Ouellette, B. F., Barton, A. B., Kaback, D. B., et, a. l. .. (1994). "Sequencing of chromosome I of Saccharomyces cerevisiae: analysis of the 42 kbp SPO7-CENI-CDC15 region." Yeast 10:535-541.7941740
- Bussey, H., Kaback, D. B., Zhong, W., Vo, D. T., Clark, M. W., Fortin, N., Hall, J., Ouellette, B. F., Keng, T., Barton, A. B., et, a. l. .. (1995). "The nucleotide sequence of chromosome I from Saccharomyces cerevisiae." Proc Natl Acad Sci U S A 92:3809-3813.7731988
- Trotta, C. R., Miao, F., Arn, E. A., Stevens, S. W., Ho, C. K., Rauhut, R., Abelson, J. N. (1997). "The yeast tRNA splicing endonuclease: a tetrameric enzyme with two active site subunits homologous to the archaeal tRNA endonucleases." Cell 89:849-858.9200603
- Yoshihisa, T., Yunoki-Esaki, K., Ohshima, C., Tanaka, N., Endo, T. (2003). "Possibility of cytoplasmic pre-tRNA splicing: the yeast tRNA splicing endonuclease mainly localizes on the mitochondria." Mol Biol Cell 14:3266-3279.12925762
|
|---|