| Identification |
|---|
| Name | Putative pterin-4-alpha-carbinolamine dehydratase |
|---|
| Synonyms | - PHS
- 4-alpha-hydroxy-tetrahydropterin dehydratase
- Pterin carbinolamine dehydratase
- PCD
|
|---|
| Gene Name | Not Available |
|---|
| Enzyme Class | |
|---|
| Biological Properties |
|---|
| General Function | Involved in 4-alpha-hydroxytetrahydrobiopterin dehydratase activity |
|---|
| Specific Function | (6R)-6-(L-erythro-1,2-dihydroxypropyl)- 5,6,7,8-tetrahydro-4a-hydroxypterin = (6R)-6-(L-erythro-1,2- dihydroxypropyl)-7,8-dihydro-6H-pterin + H(2)O |
|---|
| Cellular Location | Not Available |
|---|
| SMPDB Pathways | Not Available |
|---|
| KEGG Pathways | Not Available |
|---|
| SMPDB Reactions | Not Available |
|---|
| KEGG Reactions | Not Available |
|---|
| Metabolites | | YMDB ID | Name | View |
|---|
| YMDB00030 | Dihydrobiopterin | Show | | YMDB00984 | (6R)-6-(l-erythro-1,2-dihydroxypropyl)-5,6,7,8-tetrahydro-4a-hydroxypterin | Show |
|
|---|
| GO Classification | | Component |
|---|
| Not Available | | Function |
|---|
| catalytic activity | | lyase activity | | carbon-oxygen lyase activity | | hydro-lyase activity | | 4-alpha-hydroxytetrahydrobiopterin dehydratase activity | | Process |
|---|
| metabolic process | | biosynthetic process | | cellular biosynthetic process | | heterocycle biosynthetic process | | pteridine and derivative biosynthetic process | | tetrahydrobiopterin biosynthetic process |
|
|---|
| Gene Properties |
|---|
| Chromosome Location | Not Available |
|---|
| Locus | YHL018W |
|---|
| Gene Sequence | >363 bp
ATGCACAACAAGATTGTTAGAATCGCGTCCAGTGCACTCACAGGGGGCAAACTACTCGAG
AAGCTAAAACCCTTGACCCGTTGGGAAGTTCAATGGGACCCTAATAAGACCAAATGTTTG
GGAATAACAAGAGAGGTAACATTCAAGGACTACGAAACCACATGGGCCTTTTTGACTCGT
GTATCGATGAGATCTCATCTATGGGGCCACCATCCCCTGATTCACACAAGTTACACCTGG
GTCAAGCTGGAACTTCATACGCATGACATAGACCCGAAAGACGGGGCTCACAGCCAGCTT
AGCGATATAGACGTCCGGATGGCCAAGAGAATAGATTCCTACATCGATGAGATGACAACT
TGA |
|---|
| Protein Properties |
|---|
| Pfam Domain Function | |
|---|
| Protein Residues | 120 |
|---|
| Protein Molecular Weight | 14026.0 |
|---|
| Protein Theoretical pI | 9.09 |
|---|
| Signalling Regions | |
|---|
| Transmembrane Regions | |
|---|
| Protein Sequence | >Putative pterin-4-alpha-carbinolamine dehydratase
MHNKIVRIASSALTGGKLLEKLKPLTRWEVQWDPNKTKCLGITREVTFKDYETTWAFLTR
VSMRSHLWGHHPLIHTSYTWVKLELHTHDIDPKDGAHSQLSDIDVRMAKRIDSYIDEMTT
|
|---|
| References |
|---|
| External Links | |
|---|
| General Reference | - Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
- Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
- Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
|
|---|