Identification
NameATP synthase subunit gamma, mitochondrial
Synonyms
  • F-ATPase gamma subunit
Gene NameATP3
Enzyme ClassNot Available
Biological Properties
General FunctionEnergy production and conversion
Specific FunctionMitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and the central stalk which is part of the complex rotary element. The gamma subunit protrudes into the catalytic domain formed of alpha(3)beta(3). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits
Cellular LocationMitochondrion. Mitochondrion inner membrane; Peripheral membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
GO Classification
Component
proton-transporting ATP synthase complex, catalytic core F(1)
macromolecular complex
protein complex
proton-transporting two-sector ATPase complex, catalytic domain
Function
ion transmembrane transporter activity
cation transmembrane transporter activity
proton-transporting ATPase activity, rotational mechanism
inorganic cation transmembrane transporter activity
hydrogen ion transporting ATP synthase activity, rotational mechanism
monovalent inorganic cation transmembrane transporter activity
hydrogen ion transmembrane transporter activity
transporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
Process
ATP synthesis coupled proton transport
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
metabolic process
purine nucleoside triphosphate biosynthetic process
purine ribonucleoside triphosphate biosynthetic process
ATP biosynthetic process
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>933 bp ATGTTGTCAAGAATTGTATCAAACAATGCAACACGCTCCGTAATGTGCCACCAAGCGCAA GTGGGTATTCTTTATAAGACTAACCCAGTGAGAACTTATGCTACTTTGAAAGAAGTGGAA ATGCGTTTGAAATCTATCAAAAATATTGAGAAGATCACAAAAACTATGAAGATTGTTGCA TCTACAAGATTGAGTAAAGCTGAAAAGGCTAAAATTTCCGCAAAGAAGATGGATGAAGCA GAGCAGTTGTTTTACAAGAACGCCGAAACCAAAAATTTGGATGTTGAGGCTACTGAAACA GGTGCTCCTAAAGAGTTGATTGTTGCTATCACCTCTGATAAGGGGTTGTGTGGTTCTATC CACTCTCAATTGGCTAAAGCTGTGAGAAGACATTTGAATGATCAACCAAACGCCGATATA GTCACTATTGGTGATAAAATTAAAATGCAGCTATTGAGAACCCATCCTAACAACATTAAA TTGTCTATTAATGGAATTGGTAAAGATGCCCCAACTTTCCAAGAATCTGCTTTGATTGCC GATAAGTTATTGAGTGTCATGAAGGCCGGCACTTACCCAAAGATTTCCATTTTCTACAAT GACCCAGTGTCTTCCCTATCTTTTGAACCATCTGAAAAACCGATCTTTAACGCCAAGACC ATTGAACAATCCCCATCATTCGGCAAATTTGAGATCGACACGGACGCAAACGTTCCAAGA GATTTGTTTGAATATACTTTGGCTAACCAAATGTTGACAGCAATGGCTCAAGGTTATGCT GCTGAAATTTCCGCCAGAAGAAACGCTATGGATAACGCTTCCAAGAATGCCGGTGATATG ATCAATCGTTACTCTATCTTGTACAACAGAACAAGACAAGCTGTCATTACTAATGAACTG GTTGATATTATTACTGGTGCTTCCTCTTTGGGA
Protein Properties
Pfam Domain Function
Protein Residues311
Protein Molecular Weight34350.19922
Protein Theoretical pI9.85
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>ATP synthase subunit gamma, mitochondrial MLSRIVSNNATRSVMCHQAQVGILYKTNPVRTYATLKEVEMRLKSIKNIEKITKTMKIVA STRLSKAEKAKISAKKMDEAEQLFYKNAETKNLDVEATETGAPKELIVAITSDKGLCGSI HSQLAKAVRRHLNDQPNADIVTIGDKIKMQLLRTHPNNIKLSINGIGKDAPTFQESALIA DKLLSVMKAGTYPKISIFYNDPVSSLSFEPSEKPIFNAKTIEQSPSFGKFEIDTDANVPR DLFEYTLANQMLTAMAQGYAAEISARRNAMDNASKNAGDMINRYSILYNRTRQAVITNEL VDIITGASSLG
References
External Links
ResourceLink
Saccharomyces Genome Database ATP3
Uniprot IDP38077
Uniprot NameATPG_YEAST
GenBank Gene IDAB036928
Genebank Protein ID37359702
General Reference
  • Paul, M. F., Ackerman, S., Yue, J., Arselin, G., Velours, J., Tzagolof, A., Ackermann S [corrected to Ackerman, S. (1994). "Cloning of the yeast ATP3 gene coding for the gamma-subunit of F1 and characterization of atp3 mutants." J Biol Chem 269:26158-26164.7929329
  • Weber, E. R., Rooks, R. S., Shafer, K. S., Chase, J. W., Thorsness, P. E. (1995). "Mutations in the mitochondrial ATP synthase gamma subunit suppress a slow-growth phenotype of yme1 yeast lacking mitochondrial DNA." Genetics 140:435-442.7498726
  • Ohnishi, K., Ishibashi, S., Kunihiro, M., Satoh, T., Matsubara, K., Oku, S., Ono, B., Mabuchi, T., Takeda, M. (2003). "Studies on the ATP3 gene of Saccharomyces cerevisiae: presence of two closely linked copies, ATP3a and ATP3b, on the right arm of chromosome II." Yeast 20:943-954.12898710
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Stock, D., Leslie, A. G., Walker, J. E. (1999). "Molecular architecture of the rotary motor in ATP synthase." Science 286:1700-1705.10576729
  • Kabaleeswaran, V., Puri, N., Walker, J. E., Leslie, A. G., Mueller, D. M. (2006). "Novel features of the rotary catalytic mechanism revealed in the structure of yeast F1 ATPase." EMBO J 25:5433-5442.17082766
  • Kabaleeswaran, V., Shen, H., Symersky, J., Walker, J. E., Leslie, A. G., Mueller, D. M. (2009). "Asymmetric structure of the yeast F1 ATPase in the absence of bound nucleotides." J Biol Chem 284:10546-10551.19233840