| Identification |
|---|
| Name | Cytochrome b-c1 complex subunit 10 |
|---|
| Synonyms | - Complex III subunit 10
- Complex III subunit XI
- Ubiquinol-cytochrome c reductase complex 8.5 kDa protein
|
|---|
| Gene Name | QCR10 |
|---|
| Enzyme Class | Not Available |
|---|
| Biological Properties |
|---|
| General Function | Involved in aerobic respiration |
|---|
| Specific Function | Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain that generates an electrochemical potential coupled to ATP synthesis. The complex couples electron transfer from ubiquinol to cytochrome c. QCR10 is required for stable association of the iron-sulfur protein with the complex |
|---|
| Cellular Location | Mitochondrion inner membrane |
|---|
| SMPDB Pathways | Not Available |
|---|
| KEGG Pathways | Not Available |
|---|
| SMPDB Reactions | Not Available |
|---|
| KEGG Reactions | Not Available |
|---|
| Metabolites | |
|---|
| GO Classification | Not Available |
|---|
| Gene Properties |
|---|
| Chromosome Location | Not Available |
|---|
| Locus | |
|---|
| Gene Sequence | >234 bp
ATGGCGTACACTTCTCATCTGTCTTCAAAAACTGGTCTACATTTCGGTAGACTTTCTTTA
AGAAGTTTAACAGCTTATGCTCCGAATTTAATGTTATGGGGTGGTGCTAGCATGCTTGGG
CTATTTGTATTCACAGAAGGATGGCCTAAGTTTCAAGATACGCTATACAAAAAGATTCCG
TTGTTAGGACCTACATTGGAAGATCATACTCCACCAGAAGATAAACCTAATTGA |
|---|
| Protein Properties |
|---|
| Pfam Domain Function | |
|---|
| Protein Residues | 77 |
|---|
| Protein Molecular Weight | 8592.90039 |
|---|
| Protein Theoretical pI | 8.99 |
|---|
| Signalling Regions | |
|---|
| Transmembrane Regions | |
|---|
| Protein Sequence | >Cytochrome b-c1 complex subunit 10
MAYTSHLSSKTGLHFGRLSLRSLTAYAPNLMLWGGASMLGLFVFTEGWPKFQDTLYKKIP
LLGPTLEDHTPPEDKPN |
|---|
| References |
|---|
| External Links | |
|---|
| General Reference | - Brandt, U., Uribe, S., Schagger, H., Trumpower, B. L. (1994). "Isolation and characterization of QCR10, the nuclear gene encoding the 8.5-kDa subunit 10 of the Saccharomyces cerevisiae cytochrome bc1 complex." J Biol Chem 269:12947-12953.8175712
- Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
- Geier, B. M., Schagger, H., Brandt, U., Colson, A. M., Von Jagow, G. (1992). "Point mutation in cytochrome b of yeast ubihydroquinone:cytochrome-c oxidoreductase causing myxothiazol resistance and facilitated dissociation of the iron-sulfur subunit." Eur J Biochem 208:375-380.1325905
- Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
|
|---|