| Identification |
|---|
| Name | Mating hormone A-factor 1 |
|---|
| Synonyms | Not Available |
|---|
| Gene Name | MFA1 |
|---|
| Enzyme Class | Not Available |
|---|
| Biological Properties |
|---|
| General Function | pheromone-dependent signal transduction involved in conjugation with cellular fusion |
|---|
| Specific Function | The active factor is excreted into the culture medium by haploid cells of the A mating type and acts on cells of the opposite mating type (type alpha). It mediates the conjugation process between the two types by inhibiting the initiation of DNA synthesis in type alpha cells and synchronizing them with type A. |
|---|
| Cellular Location | Not Available |
|---|
| SMPDB Pathways | | Stress-activated signalling pathways: pheromone stress test 1 | PW012843 |    |
|
|---|
| KEGG Pathways | Not Available |
|---|
| SMPDB Reactions | Not Available |
|---|
| KEGG Reactions | Not Available |
|---|
| Metabolites | |
|---|
| GO Classification | | Function |
|---|
| pheromone-dependent signal transduction involved in conjugation with cellular fusion | | extracellular region | | plasma membrane | | mating pheromone activity |
|
|---|
| Gene Properties |
|---|
| Chromosome Location | Not Available |
|---|
| Locus | |
|---|
| Gene Sequence | >111 bp
ATGCAACCATCTACCGCTACCGCCGCTCCAAAAGAAAAGACCAGCAGTGAAAAGAAGGAC
AACTATATTATCAAAGGTGTCTTCTGGGACCCAGCATGTGTTATTGCTTAG |
|---|
| Protein Properties |
|---|
| Pfam Domain Function | Not Available |
|---|
| Protein Residues | 36 |
|---|
| Protein Molecular Weight | 3926.475 |
|---|
| Protein Theoretical pI | Not Available |
|---|
| Signalling Regions | Not Available |
|---|
| Transmembrane Regions | Not Available |
|---|
| Protein Sequence | >Mating hormone A-factor 1
MQPSTATAAPKEKTSSEKKDNYIIKGVFWDPACVIA |
|---|
| References |
|---|
| External Links | | Resource | Link |
|---|
| Saccharomyces Genome Database | MFA1 | | Uniprot ID | P34165 | | Uniprot Name | MFA1 |
|
|---|
| General Reference | Not Available |
|---|