| Identification |
|---|
| Name | Plasma membrane ATPase proteolipid 1 |
|---|
| Synonyms | Not Available |
|---|
| Gene Name | PMP1 |
|---|
| Enzyme Class | Not Available |
|---|
| Biological Properties |
|---|
| General Function | Involved in enzyme regulator activity |
|---|
| Specific Function | Not Available |
|---|
| Cellular Location | Cell membrane |
|---|
| SMPDB Pathways | Not Available |
|---|
| KEGG Pathways | Not Available |
|---|
| SMPDB Reactions | Not Available |
|---|
| KEGG Reactions | Not Available |
|---|
| Metabolites | |
|---|
| GO Classification | Not Available |
|---|
| Gene Properties |
|---|
| Chromosome Location | Not Available |
|---|
| Locus | |
|---|
| Gene Sequence | >123 bp
ATGACTTTACCAGGTGGTGTTATTTTAGTTTTCATTTTGGTCGGTTTGGCTTGTATTGCC
ATTATTGCTACCATTATCTACAGAAAATGGCAAGCTAGACAAAGAGGATTGCAAAGATTC
TAA |
|---|
| Protein Properties |
|---|
| Pfam Domain Function | |
|---|
| Protein Residues | 40 |
|---|
| Protein Molecular Weight | 4500.5 |
|---|
| Protein Theoretical pI | 12.06 |
|---|
| Signalling Regions | |
|---|
| Transmembrane Regions | |
|---|
| Protein Sequence | >Plasma membrane ATPase proteolipid 1
MTLPGGVILVFILVGLACIAIIATIIYRKWQARQRGLQRF |
|---|
| References |
|---|
| External Links | |
|---|
| General Reference | - Navarre, C., Ghislain, M., Leterme, S., Ferroud, C., Dufour, J. P., Goffeau, A. (1992). "Purification and complete sequence of a small proteolipid associated with the plasma membrane H(+)-ATPase of Saccharomyces cerevisiae." J Biol Chem 267:6425-6428.1532582
- Oliver, S. G., van der Aart, Q. J., Agostoni-Carbone, M. L., Aigle, M., Alberghina, L., Alexandraki, D., Antoine, G., Anwar, R., Ballesta, J. P., Benit, P., et, a. l. .. (1992). "The complete DNA sequence of yeast chromosome III." Nature 357:38-46.1574125
- Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
|
|---|