You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameNeutral trehalase
Synonyms
  • Alpha,alpha-trehalase
  • Alpha,alpha-trehalose glucohydrolase
Gene NameNTH1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionAlpha,alpha-trehalose + H(2)O = 2 D-glucose
Cellular LocationCytoplasm
SMPDB Pathways
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Starch and sucrose metabolismec00500 Map00500
SMPDB Reactions
Trehalose + waterD-Glucose
KEGG Reactions
water + TrehaloseD-Glucose
Metabolites
YMDB IDNameView
YMDB00008TrehaloseShow
YMDB00286D-GlucoseShow
YMDB00890waterShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
alpha,alpha-trehalase activity
catalytic activity
binding
ion binding
cation binding
metal ion binding
hydrolase activity
calcium ion binding
hydrolase activity, acting on glycosyl bonds
hydrolase activity, hydrolyzing O-glycosyl compounds
trehalase activity
Process
trehalose catabolic process
metabolic process
oligosaccharide metabolic process
disaccharide metabolic process
trehalose metabolic process
primary metabolic process
carbohydrate metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR001C
Gene Sequence>2256 bp ATGAGTCAAGTTAATACAAGCCAAGGACCGGTAGCCCAAGGCCGTCAAAGAAGATTATCA TCACTAAGTGAATTCAATGATCCATTTTCGAACGCAGAAGTCTACTATGGCCCCCCAACA GACCCAAGAAAGCAGAAGCAGGCAAAGCCCGCTAAGATCAACCGTACGAGGACTATGAGT GTTTTCGATAATGTATCTCCTTTCAAGAAAACTGGTTTTGGTAAACTTCAACAGACTAGA CGTGGTTCTGAGGATGACACCTATTCAAGTAGTCAAGGTAATCGTCGTTTCTTTATCGAA GATGTCGATAAAACACTTAATGAACTACTGGCTGCTGAGGATACCGATAAAAATTATCAG ATCACCATCGAGGATACCGGTCCAAAAGTTTTGAAAGTCGGTACCGCAAACTCCTATGGC TATAAGCATATTAATATTAGGGGTACGTATATGTTATCCAATTTGTTGCAGGAACTAACT ATTGCGAAAAGTTTTGGTAGACACCAAATTTTCTTAGATGAAGCTCGTATAAACGAAAAT CCCGTCAACAGATTATCAAGATTGATAAACACACAGTTCTGGAACTCTTTGACCAGGAGA GTTGATCTGAACAACGTAGGCGAAATTGCAAAAGATACCAAGATTGATACGCCGGGGGCA AAAAATCCAAGAATCTATGTTCCTTATGATTGTCCAGAACAATACGAATTTTATGTTCAA GCTTCTCAAATGCATCCATCTTTGAAATTAGAAGTTGAATATTTACCAAAAAAAATAACG GCAGAATACGTCAAATCCGTCAATGATACCCCCGGTTTACTAGCATTGGCTATGGAAGAG CACTTCAATCCTTCTACTGGTGAAAAAACTCTCATTGGTTACCCTTATGCTGTTCCTGGT GGTAGATTCAATGAATTATATGGTTGGGACTCCTATATGATGGCACTAGGTCTCCTAGAA GCCAACAAGACTGATGTTGCAAGAGGTATGGTGGAGCATTTTATTTTTGAGATTAATCAC TATGGAAAAATATTGAATGCTAACAGAAGCTACTATCTATGTAGATCACAGCCCCCATTC TTGACTGAAATGGCCTTGGTAGTATTCAAAAAACTTGGTGGTAGGAGTAATCCCGATGCT GTGGATTTGTTGAAAAGAGCTTTCCAAGCAAGCATAAAAGAGTACAAAACTGTTTGGACC GCATCTCCAAGGCTTGATCCCGAAACAGGCTTATCCAGGTACCATCCTAACGGTCTCGGT ATTCCTCCGGAAACTGAAAGTGATCACTTCGATACCGTTTTACTACCATATGCATCGAAA CACGGCGTTACCTTAGACGAATTTAAGCAACTTTATAACGATGGTAAGATAAAGGAGCCT AAATTGGATGAGTTTTTTCTTCATGACCGTGGCGTTAGAGAATCTGGACACGACACTACA TATAGGTTTGAGGGCGTATGTGCCTACCTGGCCACTATTGACCTGAATTCTCTTCTTTAC AAATACGAGATTGATATTGCGGACTTCATAAAGGAATTCTGCGACGACAAATATGAAGAT CCTTTAGACCATTCTATAACAACTTCAGCTATGTGGAAAGAAATGGCCAAAATCAGACAA GAAAAGATTACCAAATATATGTGGGATGACGAGTCGGGGTTTTTCTTTGACTACAACACA AAAATCAAGCACAGAACGTCATACGAATCCGCAACTACATTCTGGGCATTATGGGCTGGA CTTGCCACGAAGGAGCAAGCACAGAAAATGGTGGAGAAAGCACTACCCAAGTTAGAGATG CTTGGAGGTTTAGCTGCATGTACGGAGCGTTCTCGAGGCCCAATTTCTATTTCGAGACCA ATTAGACAATGGGACTATCCATTTGGTTGGGCACCCCATCAAATTCTTGCTTGGGAAGGC CTCCGTTCTTATGGTTATTTAACTGTAACGAATAGGCTAGCTTATAGATGGCTTTTCATG ATGACAAAGGCTTTTGTCGATTATAATGGTATTGTGGTTGAAAAATATGATGTCACAAGA GGAACAGATCCTCATCGTGTTGAAGCAGAATACGGTAATCAAGGTGCTGACTTTAAAGGG GCAGCTACTGAAGGTTTTGGATGGGTCAATGCCCGTTACATTCTTGGTTTGAAGTATATG AACAGTTACGAAAGAAGAGAGATTGGTGCTTGCATTCCACCAATATCATTCTTTAGCAGT TTAAGGCCTCAAGAAAGAAACCTCTATGGACTATAG
Protein Properties
Pfam Domain Function
Protein Residues751
Protein Molecular Weight85878.5
Protein Theoretical pI7.88
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Neutral trehalase MSQVNTSQGPVAQGRQRRLSSLSEFNDPFSNAEVYYGPPTDPRKQKQAKPAKINRTRTMS VFDNVSPFKKTGFGKLQQTRRGSEDDTYSSSQGNRRFFIEDVDKTLNELLAAEDTDKNYQ ITIEDTGPKVLKVGTANSYGYKHINIRGTYMLSNLLQELTIAKSFGRHQIFLDEARINEN PVNRLSRLINTQFWNSLTRRVDLNNVGEIAKDTKIDTPGAKNPRIYVPYDCPEQYEFYVQ ASQMHPSLKLEVEYLPKKITAEYVKSVNDTPGLLALAMEEHFNPSTGEKTLIGYPYAVPG GRFNELYGWDSYMMALGLLEANKTDVARGMVEHFIFEINHYGKILNANRSYYLCRSQPPF LTEMALVVFKKLGGRSNPDAVDLLKRAFQASIKEYKTVWTASPRLDPETGLSRYHPNGLG IPPETESDHFDTVLLPYASKHGVTLDEFKQLYNDGKIKEPKLDEFFLHDRGVRESGHDTT YRFEGVCAYLATIDLNSLLYKYEIDIADFIKEFCDDKYEDPLDHSITTSAMWKEMAKIRQ EKITKYMWDDESGFFFDYNTKIKHRTSYESATTFWALWAGLATKEQAQKMVEKALPKLEM LGGLAACTERSRGPISISRPIRQWDYPFGWAPHQILAWEGLRSYGYLTVTNRLAYRWLFM MTKAFVDYNGIVVEKYDVTRGTDPHRVEAEYGNQGADFKGAATEGFGWVNASYILGLKYM NSHARRALGACIPPISFFSSLRPQERNLYGL
References
External Links
ResourceLink
Saccharomyces Genome Database NTH1
Uniprot IDP32356
Uniprot NameTREA_YEAST
GenBank Gene IDX65925
Genebank Protein ID498787
General Reference
  • Kopp, M., Muller, H., Holzer, H. (1993). "Molecular analysis of the neutral trehalase gene from Saccharomyces cerevisiae." J Biol Chem 268:4766-4774.8444853
  • Kopp, M., Nwaka, S., Holzer, H. (1994). "Corrected sequence of the yeast neutral trehalase-encoding gene (NTH1): biological implications." Gene 150:403-404.7821816
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • App, H., Holzer, H. (1989). "Purification and characterization of neutral trehalase from the yeast ABYS1 mutant." J Biol Chem 264:17583-17588.2507544
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956