| Identification |
|---|
| Name | Synaptobrevin homolog 1 |
|---|
| Synonyms | Not Available |
|---|
| Gene Name | SNC1 |
|---|
| Enzyme Class | Not Available |
|---|
| Biological Properties |
|---|
| General Function | Involved in SNAP receptor activity |
|---|
| Specific Function | SNC1 and SNC2 are vesicle-targeting proteins essential for normal secretory traffic between the Golgi and the plasma membrane. They may also be involved in vesicle fusion |
|---|
| Cellular Location | Endomembrane system; Single-pass type IV membrane protein. |
|---|
| SMPDB Pathways | Not Available |
|---|
| KEGG Pathways | Not Available |
|---|
| SMPDB Reactions | Not Available |
|---|
| KEGG Reactions | Not Available |
|---|
| Metabolites | |
|---|
| GO Classification | | Component |
|---|
| integral to membrane | | cell part | | membrane part | | intrinsic to membrane | | Process |
|---|
| establishment of localization | | transport | | vesicle-mediated transport |
|
|---|
| Gene Properties |
|---|
| Chromosome Location | Not Available |
|---|
| Locus | |
|---|
| Gene Sequence | >354 bp
ATGTCGTCATCTACTCCCTTTGACCCTTATGCTCTATCCGAGCACGATGAAGAACGACCC
CAGAATGTACAGTCTAAGTCAAGGACTGCGGAACTACAAGCGGAAATTGATGATACCGTG
GGAATAATGAGAGATAACATAAATAAAGTAGCAGAAAGAGGTGAAAGATTAACGTCCATT
GAAGATAAAGCCGATAACCTAGCGGTCTCAGCCCAAGGCTTTAAGAGGGGTGCCAATAGG
GTCAGAAAAGCCATGTGGTACAAGGATCTAAAAATGAAGATGTGTCTGGCTTTAGTAATC
ATCATATTGCTTGTTGTAATCATCGTCCCCATTGCTGTTCACTTTAGTCGATAG |
|---|
| Protein Properties |
|---|
| Pfam Domain Function | |
|---|
| Protein Residues | 117 |
|---|
| Protein Molecular Weight | 13201.09961 |
|---|
| Protein Theoretical pI | 8.49 |
|---|
| Signalling Regions | |
|---|
| Transmembrane Regions | |
|---|
| Protein Sequence | >Synaptobrevin homolog 1
MSSSTPFDPYALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGERLTSI
EDKADNLAVSAQGFKRGANRVRKAMWYKDLKMKMCLALVIIILLVVIIVPIAVHFSR |
|---|
| References |
|---|
| External Links | |
|---|
| General Reference | - Gerst, J. E., Rodgers, L., Riggs, M., Wigler, M. (1992). "SNC1, a yeast homolog of the synaptic vesicle-associated membrane protein/synaptobrevin gene family: genetic interactions with the RAS and CAP genes." Proc Natl Acad Sci U S A 89:4338-4342.1316605
- Bussey, H., Kaback, D. B., Zhong, W., Vo, D. T., Clark, M. W., Fortin, N., Hall, J., Ouellette, B. F., Keng, T., Barton, A. B., et, a. l. .. (1995). "The nucleotide sequence of chromosome I from Saccharomyces cerevisiae." Proc Natl Acad Sci U S A 92:3809-3813.7731988
- Peng, J., Schwartz, D., Elias, J. E., Thoreen, C. C., Cheng, D., Marsischky, G., Roelofs, J., Finley, D., Gygi, S. P. (2003). "A proteomics approach to understanding protein ubiquitination." Nat Biotechnol 21:921-926.12872131
- Valdez-Taubas, J., Pelham, H. (2005). "Swf1-dependent palmitoylation of the SNARE Tlg1 prevents its ubiquitination and degradation." EMBO J 24:2524-2532.15973437
|
|---|