| Identification |
|---|
| Name | Pheromone receptor transcription factor |
|---|
| Synonyms | |
|---|
| Gene Name | MCM1 |
|---|
| Enzyme Class | Not Available |
|---|
| Biological Properties |
|---|
| General Function | regulation of mating type switching |
|---|
| Specific Function | Transcription factor required for the efficient replication of minichromosomes and the transcriptional regulation of early cell cycle genes. Activates transcription of ECB-dependent genes during the G1/M phase. Genes that contain a ECB (early cell box) element in their transcription regulatory region are transcribed only during G1/M phases. Interacts with the alpha-2 repressor or with the alpha-1 activator thereby regulating the expression of mating-type-specific genes. With ARG80, ARG81 and ARG82, coordinates the expression of arginine anabolic and catabolic genes in response to arginine. |
|---|
| Cellular Location | Not Available |
|---|
| SMPDB Pathways | | Stress-activated signalling pathways: high osmolarity test 1 | PW002773 |    | | Stress-activated signalling pathways: pheromone stress test 1 | PW012843 |    |
|
|---|
| KEGG Pathways | Not Available |
|---|
| SMPDB Reactions | Not Available |
|---|
| KEGG Reactions | Not Available |
|---|
| Metabolites | |
|---|
| GO Classification | | Function |
|---|
| transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding | | transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding | | arginine metabolic process | | DNA replication initiation | | negative regulation of arginine catabolic process by negative regulation of transcription from RNA polymerase II promoter | | negative regulation of mating-type specific transcription from RNA polymerase II promoter | | negative regulation of transcription from RNA polymerase II promoter | | cytosol | | positive regulation of arginine biosynthetic process by positive regulation of transcription from RNA polymerase II promoter | | nucleus | | positive regulation of mating-type specific transcription from RNA polymerase II promoter | | positive regulation of transcription from RNA polymerase II promoter | | positive regulation of transcription involved in G2/M transition of mitotic cell cycle | | nuclear chromatin | | regulation of mating type switching | | DNA replication origin binding | | RNA polymerase II activating transcription factor binding | | RNA polymerase II core promoter proximal region sequence-specific DNA binding | | RNA polymerase II core promoter proximal region sequence-specific DNA binding, bending | | RNA polymerase II repressing transcription factor binding | | RNA polymerase II transcription factor activity, sequence-specific transcription regulatory region DNA binding |
|
|---|
| Gene Properties |
|---|
| Chromosome Location | Not Available |
|---|
| Locus | |
|---|
| Gene Sequence | >861 bp
ATGTCAGACATCGAAGAAGGTACGCCTACTAATAATGGGCAACAGAAGGAGAGAAGAAAG
ATAGAAATTAAGTTCATCGAGAATAAAACAAGGCGCCATGTGACATTTTCCAAAAGGAAG
CACGGTATCATGAAAAAGGCGTTTGAGCTTTCTGTTCTAACGGGGACCCAGGTCCTGTTG
CTAGTCGTTTCAGAAACAGGTTTGGTATATACTTTCAGCACGCCGAAGTTTGAACCTATA
GTCACGCAGCAGGAAGGTAGAAACCTGATCCAGGCCTGTCTTAACGCCCCTGATGATGAG
GAAGAAGACGAGGAGGAAGACGGTGATGATGATGATGATGATGACGATGATGGTAATGAT
ATGCAACGCCAGCAACCACAACAACAGCAACCGCAACAACAGCAACAAGTATTGAATGCA
CACGCAAATAGCTTAGGCCATCTAAATCAAGATCAGGTACCGGCAGGCGCGCTGAAACAA
GAGGTGAAGTCACAATTGCTAGGCGGTGCCAATCCTAATCAAAACTCAATGATTCAACAG
CAGCAACATCACACGCAGAATTCACAACCACAACAGCAACAGCAACAACAACCACAGCAG
CAAATGTCACAGCAACAAATGTCACAGCATCCTCGACCACAGCAAGGAATACCACATCCG
CAACAATCGCAGCCACAGCAACAGCAACAACAACAACAACAACTGCAACAGCAGCAACAG
CAGCAACAACAACAACCCCTCACCGGCATTCATCAGCCTCACCAACAGGCTTTTGCCAAC
GCTGCCTCCCCCTATCTGAATGCTGAACAGAATGCTGCCTACCAACAATACTTTCAAGAA
CCGCAACAAGGCCAATACTAA |
|---|
| Protein Properties |
|---|
| Pfam Domain Function | Not Available |
|---|
| Protein Residues | 286 |
|---|
| Protein Molecular Weight | 32801.685 |
|---|
| Protein Theoretical pI | Not Available |
|---|
| PDB File | show |
|---|
| Signalling Regions | Not Available |
|---|
| Transmembrane Regions | Not Available |
|---|
| Protein Sequence | >Pheromone receptor transcription factor
MSDIEEGTPTNNGQQKERRKIEIKFIENKTRRHVTFSKRKHGIMKKAFELSVLTGTQVLL
LVVSETGLVYTFSTPKFEPIVTQQEGRNLIQACLNAPDDEEEDEEEDGDDDDDDDDDGND
MQRQQPQQQQPQQQQQVLNAHANSLGHLNQDQVPAGALKQEVKSQLLGGANPNQNSMIQQ
QQHHTQNSQPQQQQQQQPQQQMSQQQMSQHPRPQQGIPHPQQSQPQQQQQQQQQLQQQQQ
QQQQQPLTGIHQPHQQAFANAASPYLNAEQNAAYQQYFQEPQQGQY |
|---|
| References |
|---|
| External Links | | Resource | Link |
|---|
| Saccharomyces Genome Database | MCM1 | | Uniprot ID | P11746 | | Uniprot Name | MCM1 | | PDB ID | 1MNM |
|
|---|
| General Reference | Not Available |
|---|