You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification |
---|
Name | Invertase 5 |
---|
Synonyms | - Beta-fructofuranosidase 5
- Saccharase
- Fragment
|
---|
Gene Name | SUC5 |
---|
Enzyme Class | |
---|
Biological Properties |
---|
General Function | Involved in hydrolase activity, hydrolyzing O-glycosyl compounds |
---|
Specific Function | Hydrolysis of terminal non-reducing beta-D- fructofuranoside residues in beta-D-fructofuranosides |
---|
Cellular Location | Cytoplasmic |
---|
SMPDB Pathways | |
---|
KEGG Pathways | |
---|
SMPDB Reactions | Not Available |
---|
KEGG Reactions | Not Available |
---|
Metabolites | YMDB ID | Name | View |
---|
YMDB00286 | D-Glucose | Show | YMDB00657 | D-Fructose | Show | YMDB00890 | water | Show | YMDB00906 | Sucrose | Show |
|
---|
GO Classification | Component |
---|
Not Available | Function |
---|
catalytic activity | hydrolase activity | hydrolase activity, acting on glycosyl bonds | hydrolase activity, hydrolyzing O-glycosyl compounds | Process |
---|
metabolic process | primary metabolic process | carbohydrate metabolic process |
|
---|
Gene Properties |
---|
Chromosome Location | chromosome 4 |
---|
Locus | SUC5 |
---|
Gene Sequence | >222 bp
ATGCTTTTGCAAGCTTTCATTTTCCTTTTGGCTGGCTTTGCAGCTAAGATATCAGCATTA
ATGACAAACGAAACTAGCGATAGACCTTTGGTCCACTTCACCCCCAACAAGGGTTGGATG
AATGATCCAAATGGATTGTGGTACGATGCAAAAGAAGGTAAATGGCATCTCTACTTTCAG
TACAATCCAAATGACACTGTTTGGGGTTTGCCACTCTTCTGG |
---|
Protein Properties |
---|
Pfam Domain Function | |
---|
Protein Residues | 74 |
---|
Protein Molecular Weight | 8649.90039 |
---|
Protein Theoretical pI | 6.51 |
---|
Signalling Regions | |
---|
Transmembrane Regions | |
---|
Protein Sequence | >Invertase 5
MLLQAFIFLLAGFAAKISALMTNETSDRPLVHFTPNKGWMNDPNGLWYDAKEGKWHLYFQ
YNPNDTVWGLPLFW |
---|
References |
---|
External Links | |
---|
General Reference | - Hohmann, S., Gozalbo, D. (1988). "Structural analysis of the 5' regions of yeast SUC genes revealed analogous palindromes in SUC, MAL and GAL." Mol Gen Genet 211:446-454.2835632
|
---|