| Identification |
|---|
| Name | Invertase 3 |
|---|
| Synonyms | - Beta-fructofuranosidase 3
- Saccharase
- Fragment
|
|---|
| Gene Name | SUC3 |
|---|
| Enzyme Class | |
|---|
| Biological Properties |
|---|
| General Function | Involved in hydrolase activity, hydrolyzing O-glycosyl compounds |
|---|
| Specific Function | Hydrolysis of terminal non-reducing beta-D- fructofuranoside residues in beta-D-fructofuranosides |
|---|
| Cellular Location | Cytoplasmic |
|---|
| SMPDB Pathways | |
|---|
| KEGG Pathways | |
|---|
| SMPDB Reactions | Not Available |
|---|
| KEGG Reactions | Not Available |
|---|
| Metabolites | | YMDB ID | Name | View |
|---|
| YMDB00286 | D-Glucose | Show | | YMDB00657 | D-Fructose | Show | | YMDB00890 | water | Show | | YMDB00906 | Sucrose | Show |
|
|---|
| GO Classification | | Component |
|---|
| Not Available | | Function |
|---|
| catalytic activity | | hydrolase activity | | hydrolase activity, acting on glycosyl bonds | | hydrolase activity, hydrolyzing O-glycosyl compounds | | Process |
|---|
| metabolic process | | primary metabolic process | | carbohydrate metabolic process |
|
|---|
| Gene Properties |
|---|
| Chromosome Location | chromosome 2 |
|---|
| Locus | SUC3 |
|---|
| Gene Sequence | >222 bp
ATGCTTTTGCAAGCTTTCATTTTCCTTTTGGCTGGCTTTGCAGCTAAGATATCAGCATTA
ATGACAAACGAAACTAGCGATAGACCTTTGGTCCACTTCACCCCCAACAAGGGTTGGATG
AATGATCCAAATGGATTGTGGTACGATGCAAAAGAAGGTAAATGGCATCTCTACTTTCAG
TACAATCCAAATGACACTGTTTGGGGTTTGCCACTCTTCTGG |
|---|
| Protein Properties |
|---|
| Pfam Domain Function | |
|---|
| Protein Residues | 74 |
|---|
| Protein Molecular Weight | 8649.90039 |
|---|
| Protein Theoretical pI | 6.51 |
|---|
| Signalling Regions | |
|---|
| Transmembrane Regions | |
|---|
| Protein Sequence | >Invertase 3
MLLQAFIFLLAGFAAKISALMTNETSDRPLVHFTPNKGWMNDPNGLWYDAKEGKWHLYFQ
YNPNDTVWGLPLFW |
|---|
| References |
|---|
| External Links | |
|---|
| General Reference | - Hohmann, S., Gozalbo, D. (1988). "Structural analysis of the 5' regions of yeast SUC genes revealed analogous palindromes in SUC, MAL and GAL." Mol Gen Genet 211:446-454.2835632
|
|---|