| Identification |
|---|
| Name | GTP-binding protein RHO1 |
|---|
| Synonyms | |
|---|
| Gene Name | RHO1 |
|---|
| Enzyme Class | Not Available |
|---|
| Biological Properties |
|---|
| General Function | small GTPase mediated signal transduction |
|---|
| Specific Function | Acts as a central regulator in the cell wall integrity signaling pathway, which is regulated by the cell cycle and in response to various types of cell wall stress. Integrates signals from different cell surface sensors, and activates a set of effectors, regulating processes including beta-glucan synthesis at the site of wall remodeling, gene expression related to cell wall biogenesis, organization of the actin cytoskeleton, and protein- and secretory vesicle-targeting to the growth site. Activates the protein kinase C (PKC1) MAP kinase cascade, the beta-1,3-glucan synthase (FKS1), the formin BNI1, the exocyst component SEC3 and the transcription factor SKN7. |
|---|
| Cellular Location | Not Available |
|---|
| SMPDB Pathways | | Stress-activated signalling pathways: cell wall stress test 1 | PW007861 |    |
|
|---|
| KEGG Pathways | Not Available |
|---|
| SMPDB Reactions | Not Available |
|---|
| KEGG Reactions | Not Available |
|---|
| Metabolites | |
|---|
| GO Classification | | Function |
|---|
| actin cytoskeleton reorganization | | budding cell bud growth | | cellular bud neck septin ring organization | | positive regulation of endocytosis | | cellular bud neck | | positive regulation of protein kinase C signaling | | regulation of cell size | | GTP binding | | regulation of cell wall (1->3)-beta-D-glucan biosynthetic process | | GTPase activity | | regulation of exocyst localization | | 1,3-beta-D-glucan synthase complex | | regulation of fungal-type cell wall organization | | cellular bud tip | | regulation of protein localization | | endosome membrane | | regulation of secondary cell septum biogenesis | | Golgi apparatus | | regulation of vacuole fusion, non-autophagic | | incipient cellular bud site | | small GTPase mediated signal transduction | | mating projection tip | | peroxisomal membrane | | peroxisome | | actin cytoskeleton organization |
|
|---|
| Gene Properties |
|---|
| Chromosome Location | Not Available |
|---|
| Locus | |
|---|
| Gene Sequence | >630 bp
ATGTCACAACAAGTTGGTAACAGTATCAGAAGAAAGCTGGTAATCGTTGGTGATGGTGCC
TGTGGTAAGACATGTTTATTAATCGTCTTTTCCAAGGGCCAATTTCCAGAAGTCTACGTA
CCAACTGTCTTTGAAAACTATGTAGCAGATGTTGAAGTTGATGGGCGTCGTGTAGAGCTA
GCGCTATGGGATACCGCTGGTCAAGAAGATTATGATAGACTAAGACCATTGTCATACCCA
GACTCCAATGTCGTATTAATTTGTTTCTCTATCGATCTTCCAGATTCTTTAGAGAATGTA
CAAGAAAAATGGATTGCCGAAGTATTACATTTCTGTCAAGGTGTGCCAATTATTCTTGTT
GGTTGTAAAGTGGATTTGAGAAACGACCCACAAACCATTGAACAATTAAGACAAGAAGGT
CAACAACCCGTTACATCACAGGAGGGACAATCTGTAGCAGACCAGATTGGCGCAACCGGA
TACTACGAATGTTCGGCCAAGACTGGTTATGGTGTCAGAGAAGTGTTTGAGGCCGCCACT
AGAGCTTCATTGATGGGTAAATCTAAAACGAATGGTAAAGCTAAGAAGAACACTACTGAA
AAGAAGAAGAAGAAGTGTGTCTTGTTATAG |
|---|
| Protein Properties |
|---|
| Pfam Domain Function | Not Available |
|---|
| Protein Residues | 209 |
|---|
| Protein Molecular Weight | 23152.32 |
|---|
| Protein Theoretical pI | Not Available |
|---|
| PDB File | show |
|---|
| Signalling Regions | Not Available |
|---|
| Transmembrane Regions | Not Available |
|---|
| Protein Sequence | >GTP-binding protein RHO1
MSQQVGNSIRRKLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADVEVDGRRVEL
ALWDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFCQGVPIILV
GCKVDLRNDPQTIEQLRQEGQQPVTSQEGQSVADQIGATGYYECSAKTGYGVREVFEAAT
RASLMGKSKTNGKAKKNTTEKKKKKCVLL |
|---|
| References |
|---|
| External Links | | Resource | Link |
|---|
| Saccharomyces Genome Database | RHO1 | | Uniprot ID | P06780 | | Uniprot Name | RHO1 | | PDB ID | 3A58 |
|
|---|
| General Reference | Not Available |
|---|