| Identification |
|---|
| Name | ATP synthase protein 8 |
|---|
| Synonyms | - A6L
- ATP-associated protein 1
- F-ATPase subunit 8
|
|---|
| Gene Name | ATP8 |
|---|
| Enzyme Class | Not Available |
|---|
| Biological Properties |
|---|
| General Function | Involved in hydrogen ion transmembrane transporter acti |
|---|
| Specific Function | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane |
|---|
| Cellular Location | Mitochondrion membrane; Single-pass membrane protein |
|---|
| SMPDB Pathways | Not Available |
|---|
| KEGG Pathways | Not Available |
|---|
| SMPDB Reactions | Not Available |
|---|
| KEGG Reactions | Not Available |
|---|
| Metabolites | |
|---|
| GO Classification | | Component |
|---|
| mitochondrial proton-transporting ATP synthase complex, coupling factor F(o) | | mitochondrial membrane part | | cell part | | membrane part | | Function |
|---|
| ion transmembrane transporter activity | | cation transmembrane transporter activity | | inorganic cation transmembrane transporter activity | | monovalent inorganic cation transmembrane transporter activity | | hydrogen ion transmembrane transporter activity | | transporter activity | | transmembrane transporter activity | | substrate-specific transmembrane transporter activity | | Process |
|---|
| ATP synthesis coupled proton transport | | nitrogen compound metabolic process | | cellular nitrogen compound metabolic process | | nucleobase, nucleoside, nucleotide and nucleic acid metabolic process | | nucleobase, nucleoside and nucleotide metabolic process | | nucleoside phosphate metabolic process | | metabolic process | | nucleotide metabolic process | | purine nucleotide metabolic process | | purine nucleotide biosynthetic process | | purine nucleoside triphosphate biosynthetic process | | purine ribonucleoside triphosphate biosynthetic process | | ATP biosynthetic process |
|
|---|
| Gene Properties |
|---|
| Chromosome Location | Not Available |
|---|
| Locus | |
|---|
| Gene Sequence | >147 bp
ATGCCACAATTAGTTCCATTTTATTTTATGAATCAATTAACATATGGTTTCTTATTAATG
ATTCTATTATTAATTTTATTCTCACAATTCTTTTTACCTATGATCTTAAGATTATATGTA
TCTAGATTATTTATTTCTAAATTATAA |
|---|
| Protein Properties |
|---|
| Pfam Domain Function | |
|---|
| Protein Residues | 48 |
|---|
| Protein Molecular Weight | 5822.2002 |
|---|
| Protein Theoretical pI | 10.27 |
|---|
| Signalling Regions | |
|---|
| Transmembrane Regions | |
|---|
| Protein Sequence | >ATP synthase protein 8
MPQLVPFYFMNQLTYGFLLMITLLILFSQFFLPMILRLYVSRLFISKL |
|---|
| References |
|---|
| External Links | |
|---|
| General Reference | - Macreadie, I. G., Novitski, C. E., Maxwell, R. J., John, U., Ooi, B. G., McMullen, G. L., Lukins, H. B., Linnane, A. W., Nagley, P. (1983). "Biogenesis of mitochondria: the mitochondrial gene (aap1) coding for mitochondrial ATPase subunit 8 in Saccharomyces cerevisiae." Nucleic Acids Res 11:4435-4451.6223276
- Simon, M., Faye, G. (1984). "Organization and processing of the mitochondrial oxi3/oli2 multigenic transcript in yeast." Mol Gen Genet 196:266-274.6387398
- Foury, F., Roganti, T., Lecrenier, N., Purnelle, B. (1998). "The complete sequence of the mitochondrial genome of Saccharomyces cerevisiae." FEBS Lett 440:325-331.9872396
|
|---|