| Identification |
|---|
| Name | ATP synthase subunit a |
|---|
| Synonyms | |
|---|
| Gene Name | ATP6 |
|---|
| Enzyme Class | Not Available |
|---|
| Biological Properties |
|---|
| General Function | Energy production and conversion |
|---|
| Specific Function | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane |
|---|
| Cellular Location | Mitochondrion inner membrane; Multi-pass membrane protein |
|---|
| SMPDB Pathways | Not Available |
|---|
| KEGG Pathways | Not Available |
|---|
| SMPDB Reactions | Not Available |
|---|
| KEGG Reactions | Not Available |
|---|
| Metabolites | |
|---|
| GO Classification | | Component |
|---|
| macromolecular complex | | protein complex | | proton-transporting two-sector ATPase complex, proton-transporting domain | | proton-transporting ATP synthase complex, coupling factor F(o) | | Function |
|---|
| transporter activity | | transmembrane transporter activity | | substrate-specific transmembrane transporter activity | | ion transmembrane transporter activity | | cation transmembrane transporter activity | | inorganic cation transmembrane transporter activity | | monovalent inorganic cation transmembrane transporter activity | | hydrogen ion transmembrane transporter activity | | Process |
|---|
| nucleobase, nucleoside, nucleotide and nucleic acid metabolic process | | nucleobase, nucleoside and nucleotide metabolic process | | nucleoside phosphate metabolic process | | nucleotide metabolic process | | purine nucleotide metabolic process | | metabolic process | | purine nucleotide biosynthetic process | | purine nucleoside triphosphate biosynthetic process | | purine ribonucleoside triphosphate biosynthetic process | | ATP biosynthetic process | | ATP synthesis coupled proton transport | | nitrogen compound metabolic process | | cellular nitrogen compound metabolic process |
|
|---|
| Gene Properties |
|---|
| Chromosome Location | Not Available |
|---|
| Locus | |
|---|
| Gene Sequence | >780 bp
ATGTTTAATTTATTAAATACATATATTACATCACCATTAGATCAATTTGAGATTAGACTA
TTATTTGGTTTACAATCATCATTTATTGATTTAAGTTGTTTAAATTTAACAACATTTTCA
TTATATACTATTATTGTATTATTAGTTATTACAAGTTTATATCTATTAACTAATAATAAT
AATAAAATTATTGGTTCAAGATGATTAATTTCACAAGAAGCTATTTATGATACTATTATA
AATATGCTTAAAGGACAAATTGGAGGTAAAAATTGAGGTTTATATTTCCCTATGATCTTT
ACATTATTTATGTTTATTTTTATTGCTAATTTAATTAGTATGATTCCATACTCATTTGCA
TTATCAGCTCATTTAGTATTTATTATCTCTTTAAGTATTGTTATTTGATTAGGTAATACT
ATTTTAGGTTTATATAAACATGGTTGAGTATTCTTCTCATTATTCGTACCTGCTGGTACA
CCATTACCATTAGTACCTTTATTAGTTATTATTGAAACTTTATCTTATTTCGCTAGAGCT
ATTTCATTAGGTTTAAGATTAGGTTCTAATATCTTAGCTGGTCATTTATTAATGGTTATT
TTAGCTGGTTTACTATTTAATTTTATGTTAATTAATTTATTTACTTTAGTATTCGGTTTT
GTACCTTTAGCTATGATCTTAGCCATTATGATGTTAGAATTCGCTATTGGTATCATTCAG
GGATATGTCTGGGCTATTTTAACAGCATCATATTTAAAAGATGCAGTATACTTACATTAA
|
|---|
| Protein Properties |
|---|
| Pfam Domain Function | |
|---|
| Protein Residues | 259 |
|---|
| Protein Molecular Weight | 29098.69922 |
|---|
| Protein Theoretical pI | 8.39 |
|---|
| Signalling Regions | |
|---|
| Transmembrane Regions | - 36-56
- 92-112
- 125-145
- 150-170
- 191-211
- 216-236
|
|---|
| Protein Sequence | >ATP synthase subunit a
MFNLLNTYITSPLDQFEIRTLFGLQSSFIDLSCLNLTTFSLYTIIVLLVITSLYTLTNNN
NKIIGSRWLISQEAIYDTIMNMTKGQIGGKNWGLYFPMIFTLFMFIFIANLISMIPYSFA
LSAHLVFIISLSIVIWLGNTILGLYKHGWVFFSLFVPAGTPLPLVPLLVIIETLSYFARA
ISLGLRLGSNILAGHLLMVILAGLTFNFMLINLFTLVFGFVPLAMILAIMMLEFAIGIIQ
GYVWAILTASYLKDAVYLH |
|---|
| References |
|---|
| External Links | |
|---|
| General Reference | - Macino, G., Tzagoloff, A. (1980). "Assembly of the mitochondrial membrane system: sequence analysis of a yeast mitochondrial ATPase gene containing the oli-2 and oli-4 loci." Cell 20:507-517.6446405
- John, U. P., Nagley, P. (1987). "Sequence of the mitochondrial oli2 gene coding for subunit 6 of the mitochondrial ATPase complex in different strains of Saccharomyces." Nucleic Acids Res 15:366.2950378
- Foury, F., Roganti, T., Lecrenier, N., Purnelle, B. (1998). "The complete sequence of the mitochondrial genome of Saccharomyces cerevisiae." FEBS Lett 440:325-331.9872396
- Michon, T., Galante, M., Velours, J. (1988). "NH2-terminal sequence of the isolated yeast ATP synthase subunit 6 reveals post-translational cleavage." Eur J Biochem 172:621-625.2894987
|
|---|