Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProbable phospholipid-transporting ATPase DNF2
SynonymsNot Available
Gene NameDNF2
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionThis magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of phospholipids. Required for protein transport from Golgi to vacuoles
Cellular LocationCell membrane; Multi-pass membrane protein
SMPDB Pathways
Lysolipid incorporation into ERPW002532 ThumbThumb?image type=greyscaleThumb?image type=simple
Lysolipid incorporation into ER PC(10:0/10:0)PW002780 ThumbThumb?image type=greyscaleThumb?image type=simple
Lysolipid incorporation into ER PC(14:0/14:0)PW002783 ThumbThumb?image type=greyscaleThumb?image type=simple
Lysolipid incorporation into ER PC(16:0/16:0)PW002784 ThumbThumb?image type=greyscaleThumb?image type=simple
Lysolipid incorporation into ER PC(16:1(11Z)/16:1(11Z))PW002786 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG PathwaysNot Available
SMPDB Reactions
Adenosine triphosphate + water + PC(14:0/0:0)ADP + phosphate + PC(14:0/0:0)
Adenosine triphosphate + water + PE(14:0/0:0)ADP + phosphate + PE(14:0/0:0)
Adenosine triphosphate + water + Lyso-PS(14:0/0:0) → ADP + phosphate + Lyso-PS(14:0/0:0)
Lyso-PI(14:0/0:0) + Adenosine triphosphate + water → Lyso-PI(14:0/0:0) + ADP + phosphate
Lyso-PS(0:0/14:0) + Adenosine triphosphate + waterLyso-PS(0:0/14:0) + ADP + phosphate
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00890waterShow
YMDB00907phosphateShow
YMDB00914ADPShow
YMDB01175PC(14:0/0:0)Show
YMDB01194PE(14:0/0:0)Show
YMDB13347Lyso-PI(0:0/14:0)Show
YMDB13365Lyso-PS(0:0/14:0)Show
GO Classification
Component
cell part
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
phospholipid-translocating ATPase activity
ion binding
ATPase activity, coupled to transmembrane movement of ions
catalytic activity
cation binding
ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism
metal ion binding
hydrolase activity, acting on acid anhydrides
transporter activity
hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
transmembrane transporter activity
binding
nucleoside binding
purine nucleoside binding
hydrolase activity
substrate-specific transporter activity
adenyl nucleotide binding
substrate-specific transmembrane transporter activity
lipid transporter activity
adenyl ribonucleotide binding
ion transmembrane transporter activity
phospholipid transporter activity
ATP binding
magnesium ion binding
Process
nucleobase, nucleoside and nucleotide metabolic process
lipid transport
nucleoside phosphate metabolic process
metabolic process
phospholipid transport
nucleotide metabolic process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
purine nucleoside triphosphate biosynthetic process
establishment of localization
purine ribonucleoside triphosphate biosynthetic process
transport
ATP biosynthetic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR093W
Gene Sequence>4839 bp ATGTCAAGTCCCTCCAAACCCACTTCTCCCTTCGTGGATGATATTGAGCATGAATCGGGA TCAGCATCTAATGGTCTGTCGTCCATGTCACCATTTGACGATAGTTTTCAATTTGAAAAA CCCAGTAGTGCGCATGGAAATATTGAAGTAGCGAAAACCGGCGGTTCTGTTTTGAAGCGA CAATCTAAGCCAATGAAAGATATTAGCACACCCGATCTCTCAAAAGTTACTTTTGATGGA ATCGATGATTATAGTAACGATAATGATATTAATGATGATGATGAACTCAATGGTAAAAAA ACCGAGATACATGAACACGAAAATGAGGTGGATGATGACCTCCATTCGTTCCAGGCAACA CCTATGCCTAATACTGGAGGCTTTGAGGATGTTGAGTTGGATAACAATGAAGGTAGCAAC AATGATTCCCAGGCAGATCATAAGTTGAAAAGAGTACGTTTTGGTACAAGAAGAAATAAG TCAGGTAGGATAGATATAAATAGGTCAAAAACATTGAAATGGGCCAAGAAGAACTTCCAC AATGCTATTGATGAATTCAGTACAAAAGAAGACAGTCTCGAAAATTCAGCCTTGCAAAAT AGGTCTGATGAGTTGAGAACAGTTTACTATAATTTACCCTTGCCGGAGGACATGCTTGAC GAGGACGGCTTACCGTTGGCAGTTTACCCGCGTAATAAAATCAGGACTACGAAGTATACT CCATTAACATTTTTTCCCAAGAACATTCTTTTCCAATTTCATAATTTTGCCAATATTTAC TTTTTAATACTGTTGATTCTAGGTGCTTTTCAAATATTTGGTGTGACAAATCCAGGTTTT GCATCCGTTCCCCTAATTGTCATCGTAATTATCACTGCTATTAAGGATGGTATCGAAGAT TCCAGAAGGACTGTATTGGATTTAGAAGTTAATAATACAAGAACACATATCTTAAGCGGG GTGAAGAATGAAAATGTTGCTGTTGATAACGTTTCCTTATGGAGGCGTTTCAAGAAAGCG AATACAAGGGCATTGATTAAAATTTTTGAGTATTTTTCAGAAAACCTCACTGCTGCTGGT AGAGAAAAGAAGTTACAGAAAAAAAGGGAAGAATTACGAAGGAAGAGGAACTCGAGAAGC TTTGGGCCACGTGGGTCTCTGGATTCAATTGGTAGTTACAGAATGTCTGCCGACTTTGGT CGTCCCTCTTTGGATTATGAGAACCTGAATCAAACAATGTCACAGGCTAACAGGTATAAC GATGGTGAAAATTTAGTTGATCGAACGCTACAGCCAAACCCTGAATGTAGGTTTGCCAAG GATTACTGGAAAAATGTTAAAGTTGGTGATATTGTTCGTGTTCACAATAACGATGAAATT CCTGCTGATATGATCTTATTATCGACATCAGATGTTGATGGCGCTTGTTATGTGGAAACC AAAAATTTGGATGGTGAAACAAATCTAAAGGTCCGTCAATCATTAAAATGTAGCAAGATT ATTAAGAGTTCAAGGGATATTACCAGGACGAAGTTTTGGGTTGAAAGTGAAGGCCCACAT GCCAACTTGTATTCTTATCAAGGTAATTTCAAATGGCAAGATACACAAAATGGAAACATC AGAAATGAGCCTGTAAATATCAATAACTTATTATTGAGAGGTTGTACCTTGAGAAACACT AAGTGGGCCATGGGTATGGTTATTTTTACTGGTGACGATACCAAGATTATGATAAACGCT GGTGTCACTCCAACCAAAAAATCCAGAATTTCAAGAGAGTTGAATTTTTCTGTGATTTTG AATTTTGTACTATTGTTTATCCTATGTTTCACTGCTGGTATTGTTAACGGTGTTTATTAT AAACAGAAACCTCGATCGAGAGATTATTTTGAATTTGGTACCATTGGAGGTTCTGCCTCA ACTAACGGTTTTGTTTCTTTTTGGGTGGCGGTTATTCTTTATCAGTCATTGGTTCCGATC TCTTTATATATTTCTGTGGAAATTATTAAGACAGCACAGGCTATTTTCATTTACACTGAT GTTTTGTTGTATAATGCCAAGCTAGACTATCCATGTACACCAAAGTCGTGGAACATCTCC GATGATTTGGGTCAAATTGAGTATATTTTTTCAGATAAAACAGGCACCTTGACACAAAAT GTGATGGAATTCAAAAAATGTACTATTAACGGTGTGTCTTATGGACGTGCCTATACGGAG GCACTAGCAGGCCTGAGGAAGAGACAAGGTGTTGATGTCGAATCGGAAGGTCGTCGCGAA AAGGAAGAGATAGCAAAAGATAGGGAAACAATGATCGACGAATTAAGATCAATGAGTGAT AATACACAGTTTTGTCCGGAGGATTTAACTTTTGTATCTAAGGAAATTGTGGAAGACTTG AAAGGATCCAGTGGCGACCATCAACAAAAGTGCTGTGAACACTTTTTGCTGGCGCTCGCA TTATGTCATTCTGTCCTTGTGGAGCCAAATAAAGATGATCCTAAAAAACTGGACATCAAG GCTCAATCACCTGATGAGTCTGCCTTAGTTTCCACCGCCAGACAATTAGGGTACAGTTTC GTTGGTAGTTCAAAAAGTGGATTGATAGTAGAGATCCAGGGTGTTCAAAAGGAGTTCCAA GTTCTGAACGTACTTGAATTCAATTCGTCGAGAAAAAGGATGAGTTGCATTATCAAGATC CCTGGCTCTACACCAAAGGATGAACCTAAAGCACTGTTAATATGTAAAGGTGCGGATTCC GTTATCTATTCAAGATTAGATCGCACTCAAAACGACGCTACTTTGTTGGAAAAGACGGCC CTCCATTTGGAAGAATATGCCACAGAAGGTTTAAGAACATTATGTTTGGCTCAAAGAGAG CTCACGTGGTCCGAGTATGAACGTTGGGTTAAGACTTATGATGTGGCCGCTGCATCCGTT ACTAATAGGGAGGAAGAGTTGGACAAAGTTACTGACGTTATTGAACGTGAGCTTATTTTG CTTGGTGGTACGGCCATTGAGGATCGTTTACAAGATGGTGTTCCTGATTCGATTGCCCTC TTGGCCGAGGCCGGTATTAAGTTATGGGTCCTAACGGGTGATAAAGTGGAAACTGCCATT AACATTGGTTTTTCCTGCAATGTTTTGAACAATGATATGGAATTATTGGTTGTGAAGGCT TCCGGCGAAGATGTAGAAGAATTTGGTAGTGACCCTATTCAAGTGGTTAACAATTTGGTG ACAAAATACTTAAGGGAAAAATTTGGCATGAGTGGATCCGAGGAGGAGTTAAAAGAAGCT AAAAGAGAGCATGGTTTGCCACAGGGAAATTTTGCTGTCATTATCGATGGCGATGCGCTA AAAGTTGCTTTGAATGGTGAAGAAATGAGACGCAAGTTCTTGCTACTGTGTAAGAATTGT AAAGCTGTTTTGTGTTGCAGAGTTTCTCCAGCACAAAAGGCTGCAGTGGTCAAGTTGGTA AAAAAGACCTTAGACGTTATGACCTTGGCCATTGGTGATGGTTCGAATGATGTAGCCATG ATTCAATCGGCGGACGTTGGTGTTGGTATCGCGGGTGAAGAAGGCAGACAAGCTGTCATG TGTTCTGATTATGCCATCGGGCAGTTCAGATATGTGACAAGACTGGTATTGGTGCATGGT AAATGGTGTTATAAGAGACTGGCAGAGATGATCCCACAGTTTTTCTACAAGAACGTTATT TTTACGCTATCCCTGTTCTGGTATGGTATTTACAATAATTTCGATGGGTCGTATTTGTTT GAGTATACGTACTTGACATTCTACAATCTTGCATTCACATCCGTACCTGTTATTTTACTA GCAGTACTCGACCAAGATGTTTCCGACACCGTTTCGATGCTGGTGCCACAGTTGTACCGT GTGGGTATCCTAAGAAAAGAATGGAACCAAACCAAATTTCTTTGGTACATGTTGGATGGT GTATACCAATCTGTGATATGCTTCTTTTTCCCCTATTTGGCGTACCATAAAAACATGGTT GTAACTGAAAATGGCCTTGGACTAGACCACCGTTACTTTGTCGGTGTCTTCGTTACAGCA ATTGCAGTCACTTCATGTAACTTTTACGTCTTCATGGAACAGTATAGATGGGACTGGTTC TGTGGCCTATTCATATGTCTATCACTGGCCGTGTTTTACGGCTGGACGGGTATATGGACA AGCTCGTCGTCAAGTAACGAATTTTACAAGGGTGCGGCGCGTGTATTCGCACAACCTGCC TATTGGGCAGTACTTTTCGTTGGCGTGCTGTTCTGCCTACTGCCAAGATTCACCATTGAC TGTATCAGAAAGATATTCTATCCGAAAGATATAGAGATCGTTAGAGAAATGTGGTTACGC GGTGATTTTGACCTCTACCCACAAGGCTACGACCCTACGGACCCTAGCAGGCCCAGAATA AACGAAATACGTCCCCTTACAGATTTCAAAGAGCCCATTTCACTGGACACTCATTTTGAT GGTGTCAGCCACTCACAAGAGACCATAGTCACAGAGGAAATACCAATGAGTATACTCAAT GGTGAGCAAGGCTCGCGCAAGGGGTACCGTGTCTCTACCACTCTGGAACGCCGTGACCAG CTCAGCCCCGTTACAACAACGAACAACTTGCCTAGAAGATCAATGGCCAGTGCCCGCGGA AATAAGCTCAGAACTTCGCTGGATCGCACAAGAGAAGAGATGCTTGCCAACCACCAACTG GACACAAGATACTCCGTGGAAAGAGCACGTGCCTCGCTGGATCTGCCGGGTATCAATCAT GCAGAGACGCTGCTCAGCCAGCGCAGCAGGGACCGTTAA
Protein Properties
Pfam Domain Function
Protein Residues1612
Protein Molecular Weight182617.0
Protein Theoretical pI6.04
Signalling Regions
  • None
Transmembrane Regions
  • 253-273
  • 278-298
  • 599-619
  • 640-660
  • 1232-1252
  • 1263-1283
  • 1314-1334
  • 1351-1371
  • 1378-1398
  • 1419-1439
Protein Sequence>Probable phospholipid-transporting ATPase DNF2 MSSPSKPTSPFVDDIEHESGSASNGLSSMSPFDDSFQFEKPSSAHGNIEVAKTGGSVLKR QSKPMKDISTPDLSKVTFDGIDDYSNDNDINDDDELNGKKTEIHEHENEVDDDLHSFQAT PMPNTGGFEDVELDNNEGSNNDSQADHKLKRVRFGTRRNKSGRIDINRSKTLKWAKKNFH NAIDEFSTKEDSLENSALQNRSDELRTVYYNLPLPEDMLDEDGLPLAVYPRNKIRTTKYT PLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVPLIVIVIITAIKDGIED SRRTVLDLEVNNTRTHILSGVKNENVAVDNVSLWRRFKKANTRALIKIFEYFSENLTAAG REKKLQKKREELRRKRNSRSFGPRGSLDSIGSYRMSADFGRPSLDYENLNQTMSQANRYN DGENLVDRTLQPNPECRFAKDYWKNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVET KNLDGETNLKVRQSLKCSKIIKSSRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNI RNEPVNINNLLLRGCTLRNTKWAMGMVIFTGDDTKIMINAGVTPTKKSRISRELNFSVIL NFVLLFILCFTAGIVNGVYYKQKPRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPI SLYISVEIIKTAQAIFIYTDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQN VMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSD NTQFCPEDLTFVSKEIVEDLKGSSGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIK AQSPDESALVSTARQLGYSFVGSSKSGLIVEIQGVQKEFQVLNVLEFNSSRKRMSCIIKI PGSTPKDEPKALLICKGADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRE LTWSEYERWVKTYDVAAASVTNREEELDKVTDVIERELILLGGTAIEDRLQDGVPDSIAL LAEAGIKLWVLTGDKVETAINIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLV TKYLREKFGMSGSEEELKEAKREHGLPQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNC KAVLCCRVSPAQKAAVVKLVKKTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVM CSDYAIGQFRYVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLF EYTYLTFYNLAFTSVPVILLAVLDQDVSDTVSMLVPQLYRVGILRKEWNQTKFLWYMLDG VYQSVICFFFPYLAYHKNMVVTENGLGLDHRYFVGVFVTAIAVTSCNFYVFMEQYRWDWF CGLFICLSLAVFYGWTGIWTSSSSSNEFYKGAARVFAQPAYWAVLFVGVLFCLLPRFTID CIRKIFYPKDIEIVREMWLRGDFDLYPQGYDPTDPSRPRINEIRPLTDFKEPISLDTHFD GVSHSQETIVTEEIPMSILNGEQGSRKGYRVSTTLERRDQLSPVTTTNNLPRRSMASARG NKLRTSLDRTREEMLANHQLDTRYSVERARASLDLPGINHAETLLSQRSRDR
References
External Links
ResourceLink
Saccharomyces Genome Database DNF2
Uniprot IDQ12675
Uniprot NameATC4_YEAST
GenBank Gene IDZ47746
Genebank Protein ID633628
General Reference
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Hua, Z., Fatheddin, P., Graham, T. R. (2002). "An essential subfamily of Drs2p-related P-type ATPases is required for protein trafficking between Golgi complex and endosomal/vacuolar system." Mol Biol Cell 13:3162-3177.12221123
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956