Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name6-phosphofructo-2-kinase 2
Synonyms
  • 6PF-2-K 2
  • Phosphofructokinase 2 II
Gene NamePFK27
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionSynthesis of fructose 2,6-bisphosphate
Cellular LocationNot Available
SMPDB Pathways
Fructose MetabolismPW002390 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Fructose and mannose metabolismec00051 Map00051
SMPDB Reactions
β-D-fructofuranose 6-phosphate + Adenosine triphosphateADP + hydron + D-Fructose 2,6-bisphosphate
KEGG Reactions
Adenosine triphosphate + Fructose 6-phosphateD-Fructose 2,6-bisphosphate + hydron + ADP
Metabolites
YMDB IDNameView
YMDB00011D-Fructose 2,6-bisphosphateShow
YMDB00078Fructose 6-phosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00862hydronShow
YMDB00914ADPShow
YMDB16262β-D-fructofuranose 6-phosphateShow
GO Classification
Component
Not Available
Function
transferase activity, transferring phosphorus-containing groups
binding
phosphofructokinase activity
nucleoside binding
6-phosphofructo-2-kinase activity
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
catalytic activity
phosphotransferase activity, alcohol group as acceptor
transferase activity
Process
metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
fructose metabolic process
fructose 2,6-bisphosphate metabolic process
small molecule metabolic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOL136C
Gene Sequence>1194 bp ATGGGTGGTTCTTCCGATTCAGACTCTCACGATGGATATTTGACTTCCGAATATAATTCC TCGAATTCTCTTTTTTCACTTAACACCGGTAACAGCTATTCAAGCGCATCTCTCGACAGA GCCACTTTAGATTGTCAAGATTCTGTTTTTTTCGATAATCACAAAAGTTCACTGCTGTCT ACAGAGGTCCCAAGGTTTATTTCTAACGACCCGTTACACTTACCCATTACACTGAATTAC AAAAGAGATAATGCAGACCCTACGTATACAAATGGAAAAGTTAACAAGTTTATGATTGTT TTGATTGGGCTACCAGCTACTGGGAAGTCTACCATTTCTTCTCATTTAATTCAATGTTTG AAGAACAATCCACTAACTAATTCATTACGCTGTAAAGTTTTTAATGCTGGTAAGATAAGA AGGCAAATCAGTTGTGCTACCATTTCAAAGCCTTTGCTTTTGTCGAATACATCTTCGGAA GACTTATTTAATCCGAAAAATAACGATAAAAAGGAAACGTATGCCAGGATCACTTTGCAA AAGTTGTTTCACGAAATCAACAACGATGAATGTGACGTGGGAATCTTCGACGCCACAAAT TCGACCATCGAAAGAAGAAGATTTATATTTGAGGAGGTTTGTTCGTTCAATACAGATGAG CTTTCTAGTTTCAATTTGGTGCCCATAATCTTACAGGTGTCATGTTTTAACAGAAGCTTT ATCAAATACAATATCCACAATAAATCGTTTAATGAAGACTACTTAGACAAACCTTATGAA CTTGCCATCAAAGATTTTGCAAAGAGATTAAAACATTACTATTCGCAGTTTACACCTTTC TCCCTTGATGAGTTCAATCAAATCCATCGATATATCAGCCAACATGAAGAAATCGATACG AGCTTATTTTTCTTCAATGTTATCAATGCGGGCGTCGTTGAGCCACATTCTTTAAATCAA AGTCATTACCCTTCGACCTGTGGCAAGCAAATTAGGGACACCATTATGGTTATTGAAAAT TTCATCAATCACTATTCTCAGATGTTTGGTTTTGAATACATCGAAGCTGTTAAATTGTTT TTTGAAAGTTTTGGAAATAGCTCAGAGGAAACTTTAACTACACTAGACTCTGTTGTTAAT GATAAATTTTTTGATGATTTGCAGAGCCTAATTGAAAGCAACGGATTTGCTTGA
Protein Properties
Pfam Domain Function
Protein Residues397
Protein Molecular Weight45317.10156
Protein Theoretical pI5.4
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>6-phosphofructo-2-kinase 2 MGGSSDSDSHDGYLTSEYNSSNSLFSLNTGNSYSSASLDRATLDCQDSVFFDNHKSSLLS TEVPRFISNDPLHLPITLNYKRDNADPTYTNGKVNKFMIVLIGLPATGKSTISSHLIQCL KNNPLTNSLRCKVFNAGKIRRQISCATISKPLLLSNTSSEDLFNPKNNDKKETYARITLQ KLFHEINNDECDVGIFDATNSTIERRRFIFEEVCSFNTDELSSFNLVPIILQVSCFNRSF IKYNIHNKSFNEDYLDKPYELAIKDFAKRLKHYYSQFTPFSLDEFNQIHRYISQHEEIDT SLFFFNVINAGVVEPHSLNQSHYPSTCGKQIRDTIMVIENFINHYSQMFGFEYIEAVKLF FESFGNSSEETLTTLDSVVNDKFFDDLQSLIESNGFA
References
External Links
ResourceLink
Saccharomyces Genome Database PFK27
Uniprot IDQ12471
Uniprot Name6P22_YEAST
GenBank Gene IDX90861
Genebank Protein ID1085116
General Reference
  • Boles, E., Gohlmann, H. W., Zimmermann, F. K. (1996). "Cloning of a second gene encoding 5-phosphofructo-2-kinase in yeast, and characterization of mutant strains without fructose-2,6-bisphosphate." Mol Microbiol 20:65-76.8861205
  • Aldea, M., Piedrafita, L., Casas, C., Casamayor, A., Khalid, H., Balcells, L., Arino, J., Herrero, E. (1996). "Sequence analysis of a 12 801 bp fragment of the left arm of yeast chromosome XV containing a putative 6-phosphofructo-2-kinase gene, a gene for a possible glycophospholipid-anchored surface protein and six other open reading frames." Yeast 12:1053-1058.8896270
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956