You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name6-phosphofructo-2-kinase 2
Synonyms
  • 6PF-2-K 2
  • Phosphofructokinase 2 II
Gene NamePFK27
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionSynthesis of fructose 2,6-bisphosphate
Cellular LocationNot Available
SMPDB Pathways
Fructose MetabolismPW002390 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Fructose and mannose metabolismec00051 Map00051
SMPDB Reactions
β-D-fructofuranose 6-phosphate + Adenosine triphosphateADP + hydron + D-Fructose 2,6-bisphosphate
KEGG Reactions
Adenosine triphosphate + Fructose 6-phosphateD-Fructose 2,6-bisphosphate + hydron + ADP
Metabolites
YMDB IDNameView
YMDB00011D-Fructose 2,6-bisphosphateShow
YMDB00078Fructose 6-phosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00862hydronShow
YMDB00914ADPShow
YMDB16262β-D-fructofuranose 6-phosphateShow
GO Classification
Component
Not Available
Function
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
catalytic activity
phosphotransferase activity, alcohol group as acceptor
transferase activity
transferase activity, transferring phosphorus-containing groups
binding
phosphofructokinase activity
nucleoside binding
6-phosphofructo-2-kinase activity
purine nucleoside binding
Process
fructose 2,6-bisphosphate metabolic process
small molecule metabolic process
metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
fructose metabolic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOL136C
Gene Sequence>1194 bp ATGGGTGGTTCTTCCGATTCAGACTCTCACGATGGATATTTGACTTCCGAATATAATTCC TCGAATTCTCTTTTTTCACTTAACACCGGTAACAGCTATTCAAGCGCATCTCTCGACAGA GCCACTTTAGATTGTCAAGATTCTGTTTTTTTCGATAATCACAAAAGTTCACTGCTGTCT ACAGAGGTCCCAAGGTTTATTTCTAACGACCCGTTACACTTACCCATTACACTGAATTAC AAAAGAGATAATGCAGACCCTACGTATACAAATGGAAAAGTTAACAAGTTTATGATTGTT TTGATTGGGCTACCAGCTACTGGGAAGTCTACCATTTCTTCTCATTTAATTCAATGTTTG AAGAACAATCCACTAACTAATTCATTACGCTGTAAAGTTTTTAATGCTGGTAAGATAAGA AGGCAAATCAGTTGTGCTACCATTTCAAAGCCTTTGCTTTTGTCGAATACATCTTCGGAA GACTTATTTAATCCGAAAAATAACGATAAAAAGGAAACGTATGCCAGGATCACTTTGCAA AAGTTGTTTCACGAAATCAACAACGATGAATGTGACGTGGGAATCTTCGACGCCACAAAT TCGACCATCGAAAGAAGAAGATTTATATTTGAGGAGGTTTGTTCGTTCAATACAGATGAG CTTTCTAGTTTCAATTTGGTGCCCATAATCTTACAGGTGTCATGTTTTAACAGAAGCTTT ATCAAATACAATATCCACAATAAATCGTTTAATGAAGACTACTTAGACAAACCTTATGAA CTTGCCATCAAAGATTTTGCAAAGAGATTAAAACATTACTATTCGCAGTTTACACCTTTC TCCCTTGATGAGTTCAATCAAATCCATCGATATATCAGCCAACATGAAGAAATCGATACG AGCTTATTTTTCTTCAATGTTATCAATGCGGGCGTCGTTGAGCCACATTCTTTAAATCAA AGTCATTACCCTTCGACCTGTGGCAAGCAAATTAGGGACACCATTATGGTTATTGAAAAT TTCATCAATCACTATTCTCAGATGTTTGGTTTTGAATACATCGAAGCTGTTAAATTGTTT TTTGAAAGTTTTGGAAATAGCTCAGAGGAAACTTTAACTACACTAGACTCTGTTGTTAAT GATAAATTTTTTGATGATTTGCAGAGCCTAATTGAAAGCAACGGATTTGCTTGA
Protein Properties
Pfam Domain Function
Protein Residues397
Protein Molecular Weight45317.10156
Protein Theoretical pI5.4
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>6-phosphofructo-2-kinase 2 MGGSSDSDSHDGYLTSEYNSSNSLFSLNTGNSYSSASLDRATLDCQDSVFFDNHKSSLLS TEVPRFISNDPLHLPITLNYKRDNADPTYTNGKVNKFMIVLIGLPATGKSTISSHLIQCL KNNPLTNSLRCKVFNAGKIRRQISCATISKPLLLSNTSSEDLFNPKNNDKKETYARITLQ KLFHEINNDECDVGIFDATNSTIERRRFIFEEVCSFNTDELSSFNLVPIILQVSCFNRSF IKYNIHNKSFNEDYLDKPYELAIKDFAKRLKHYYSQFTPFSLDEFNQIHRYISQHEEIDT SLFFFNVINAGVVEPHSLNQSHYPSTCGKQIRDTIMVIENFINHYSQMFGFEYIEAVKLF FESFGNSSEETLTTLDSVVNDKFFDDLQSLIESNGFA
References
External Links
ResourceLink
Saccharomyces Genome Database PFK27
Uniprot IDQ12471
Uniprot Name6P22_YEAST
GenBank Gene IDX90861
Genebank Protein ID1085116
General Reference
  • Boles, E., Gohlmann, H. W., Zimmermann, F. K. (1996). "Cloning of a second gene encoding 5-phosphofructo-2-kinase in yeast, and characterization of mutant strains without fructose-2,6-bisphosphate." Mol Microbiol 20:65-76.8861205
  • Aldea, M., Piedrafita, L., Casas, C., Casamayor, A., Khalid, H., Balcells, L., Arino, J., Herrero, E. (1996). "Sequence analysis of a 12 801 bp fragment of the left arm of yeast chromosome XV containing a putative 6-phosphofructo-2-kinase gene, a gene for a possible glycophospholipid-anchored surface protein and six other open reading frames." Yeast 12:1053-1058.8896270
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956