You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSpermine synthase
Synonyms
  • SPMSY
  • Spermidine aminopropyltransferase
Gene NameSPE4
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionS-adenosylmethioninamine + spermidine = 5'- methylthioadenosine + spermine
Cellular LocationNot Available
SMPDB Pathways
Glutathione metabolismPW002395 ThumbThumb?image type=greyscaleThumb?image type=simple
beta-Alanine metabolismPW002381 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Arginine and proline metabolismec00330 Map00330
Cysteine and methionine metabolismec00270 Map00270
Glutathione metabolismec00480 Map00480
beta-Alanine metabolismec00410 Map00410
SMPDB Reactions
Spermidine + S-Adenosylmethioninaminehydron + 5'-Methylthioadenosine + Spermine
KEGG Reactions
Spermidine + S-AdenosylmethioninamineSpermine + hydron + 5'-Methylthioadenosine
Metabolites
YMDB IDNameView
YMDB00130S-AdenosylmethioninamineShow
YMDB001785'-MethylthioadenosineShow
YMDB00231SpermineShow
YMDB00232SpermidineShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
catalytic activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 12
LocusYLR146C
Gene Sequence>903 bp ATGGTTAATAATTCACAGCATCCTTACATCAAAGATGGATGGTTTAGAGAGATTAATGAT AAAAGTTTTCCGGGCCAGGCCTTTACTATGACCGTGGACTCAATACTTTATGAAGCCCGC AGTGAATTTCAGGACATCTTAATCTTCCGTAACAAGGTATACGGTACTGTTTTGGTCCTC GATGGTATTGTCCAATGTACGGAATTTGATGAGTTTGCCTATCAAGAGATGATCACCCAC ATTGCCATGTTTGCGCATTCTAATCCCAAGCGTGTACTTATCATTGGCGGTGGGGACGGA GGTGTCTTAAGGGAAGTAGCCAAGCACAGCTGTGTAGAAGATATCACTATGGTAGAAATT GACTCATCAGTGATCGAATTATCCCGTAAGTTCTTGCCCACATTGAGTAATGGTGCTTTC GATGACGAAAGGTTGGACTTGAAACTTTGCGATGGCTTCAAGTTCTTACAAGATATAGGT GCTTCCGACGTCCATAAGAAATTTGACGTCATTATTACAGATAGTTCTGATCCTGAAGGT CCAGCTGAAGCGTTTTTTCAAGAGAGGTATTTCGAACTATTGAAAGATGCTTTAAATCCT AATGGCGTTGTTATTATGCAAAGCTCTGAAAATTTTTGGTTAAATTTAAAATACTTACAT GATTTGAAAAATACAGCCAAAAAGGTATTTCCTAATACAGAATATTGCTATACCATGGTT CCAACCTATACATCTGGCCAATTAGGTTTAATTGTTTGCAGTAATAACGCCAATATACCG TTGAACATTCCGCAAAGAAAGATATCTGAGCAAGAACAAGGGAAGCTGAAGTACTATAAT CCTCAAATACATTCTAGTGCGTTTGTTTTGCCTACTTGGGCAGACAAGGTCATTAATGAA TGA
Protein Properties
Pfam Domain Function
Protein Residues300
Protein Molecular Weight34090.5
Protein Theoretical pI4.77
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Spermine synthase MVNNSQHPYIKDGWFREINDKSFPGQAFTMTVDSILYEARSEFQDILIFRNKVYGTVLVL DGIVQCTEFDEFAYQEMITHIAMFAHSNPKRVLIIGGGDGGVLREVAKHSCVEDITMVEI DSSVIELSRKFLPTLSNGAFDDERLDLKLCDGFKFLQDIGASDVHKKFDVIITDSSDPEG PAEAFFQERYFELLKDALNPNGVVIMQSSENFWLNLKYLHDLKNTAKKVFPNTEYCYTMV PTYTSGQLGLIVCSNNANIPLNIPQRKISEQEQGKLKYYNPQIHSSAFVLPTWADKVINE
References
External Links
ResourceLink
Saccharomyces Genome Database SPE4
Uniprot IDQ12455
Uniprot NameSPSY_YEAST
GenBank Gene IDAF067970
Genebank Protein ID3201943
General Reference
  • Hamasaki-Katagiri, N., Katagiri, Y., Tabor, C. W., Tabor, H. (1998). "Spermine is not essential for growth of Saccharomyces cerevisiae: identification of the SPE4 gene (spermine synthase) and characterization of a spe4 deletion mutant." Gene 210:195-201.9573363
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Zhang, Z., Dietrich, F. S. (2005). "Mapping of transcription start sites in Saccharomyces cerevisiae using 5' SAGE." Nucleic Acids Res 33:2838-2851.15905473
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956