You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NametRNA guanosine-2'-O-methyltransferase TRM13
Synonyms
  • tRNA [Gm4] methyltransferase
  • tRNA methylase 13
Gene NameTRM13
Enzyme Class
Biological Properties
General FunctionInvolved in methyltransferase activity
Specific FunctionSpecifically methylates guanosine-4 in various tRNAs with a Gly(CCG), His or Pro signature
Cellular LocationCytoplasm. Nucleus
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00198S-AdenosylhomocysteineShow
YMDB00297S-AdenosylmethionineShow
GO Classification
Component
Not Available
Function
transferase activity, transferring one-carbon groups
methyltransferase activity
catalytic activity
transferase activity
Process
macromolecule metabolic process
cellular macromolecule metabolic process
RNA metabolic process
ncRNA metabolic process
tRNA metabolic process
tRNA processing
metabolic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOL125W
Gene Sequence>1431 bp ATGTTACAAGATAATAATGGGCCCGCTGTTAAGAGGGCGAAACCCTCAGAAAGGTTGCAA TGTGAATATTTCATGGAAAAAAAGAAACGAAGATGTGGGATGACCAGGAGTTCTCAGAAC TTGTATTGTTCAGAGCATCTGAATTTGATGAAAAAGGCGGCTAATTCTCAAGTGCATAAT AAGAATGGCAGTGAAGCAGAGAAAGAAAGAGAAAGAGTACCTTGTCCGCTGGATCCTAAC CATACGGTTTGGGCAGATCAATTAAAAAAGCATTTGAAAAAATGCAATAAGACCAAACTA AGCCATTTAAACGATGATAAGCCATACTATGAACCGGGCTATAACGGAGAGAATGGACTG TTATCGTCGTCTGTTAAAATAGATATTACTGCGGAACATTTGGTACAATCTATTGAATTG CTGTATAAGGTGTTTGAGGGAGAATCCATGGACGAGCTGCCTTTGAGACAACTGAACAAT AAGCTTATGTCTCTAAAACGATTCCCTCAATTGCCTTCGAATACTAAACATGCTGTACAA CAGTCTTCACTGATCGAAAACTTAGTGGACGCTGGCGCATTTGAGAGGCCAGAAAGTTTA AACTTCATTGAGTTTGGATGTGGCAGGGCCGAATTCTCGCGCTATGTCAGTCTGTACCTT TTAACACAATTGACAAGCCTTCCAGCGGAGCACTCGGGTTCAAACTCGAACGAGTTCGTG TTGATTGACAGAGCAACTAATAGGATGAAGTTCGATAAAAAGATAAAAGACGATTTTTCA GAAATAAAGTCAAACTCACCTTCCAAACCTATTAGCTGCCCCAGCATCAAAAGGATAAAG ATCGACATTAGGGACTTGAAGATGGATCCGATTTTAAAATCGACACCTGGGGACGATATA CAATACGTGTGCATCTCAAAACACCTTTGTGGTGTAGCTACAGATCTAACTTTGAGGTGT ATAGGCAACAGCTCAATTTTACATGGCGACGATAACAACGGATGCAACCCCAAACTAAAG GCAATTTGTATTGCCATGTGCTGCAGGCATGTCTGTGACTACGGCGACTATGTCAACCGC AGTTACGTTACATCACTTGTTGAAAAGTATAGGGCCCATGGCTCCATCTTGACGTACGAA ACCTTTTTCCGCGTTTTAACTAAACTCTGTTCATGGGGTACCTGCGGAAGGAAACCAGGT ACGGCTATTACAGATATAGTAAACGTTGTCGAATCGTTTGAAGGGGCTGAGCCATATACA ATAACCATTAAAGAGAGAGAAAATATTGGATTAATGGCTAGGCGTGTAATCGACGAGGGC AGGTTGGTATATGTGAAAGAAAAGTTTACAGAGTTTAATGCGGAGCTGATAAGGTACGTA GAATCCGATGTTTCTTTAGAGAACGTTGCTATGTTAGTTTATAAGAAATAG
Protein Properties
Pfam Domain Function
Protein Residues476
Protein Molecular Weight54094.5
Protein Theoretical pI8.38
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>tRNA guanosine-2'-O-methyltransferase TRM13 MLQDNNGPAVKRAKPSERLQCEYFMEKKKRRCGMTRSSQNLYCSEHLNLMKKAANSQVHN KNGSEAEKERERVPCPLDPNHTVWADQLKKHLKKCNKTKLSHLNDDKPYYEPGYNGENGL LSSSVKIDITAEHLVQSIELLYKVFEGESMDELPLRQLNNKLMSLKRFPQLPSNTKHAVQ QSSLIENLVDAGAFERPESLNFIEFGCGRAEFSRYVSLYLLTQLTSLPAEHSGSNSNEFV LIDRATNRMKFDKKIKDDFSEIKSNSPSKPISCPSIKRIKIDIRDLKMDPILKSTPGDDI QYVCISKHLCGVATDLTLRCIGNSSILHGDDNNGCNPKLKAICIAMCCRHVCDYGDYVNR SYVTSLVEKYRAHGSILTYETFFRVLTKLCSWGTCGRKPGTAITDIVNVVESFEGAEPYT ITIKERENIGLMARRVIDEGRLVYVKEKFTEFNAELIRYVESDVSLENVAMLVYKK
References
External Links
ResourceLink
Saccharomyces Genome Database TRM13
Uniprot IDQ12383
Uniprot NameTRM13_YEAST
GenBank Gene IDU41293
Genebank Protein ID1209716
General Reference
  • Casamayor, A., Khalid, H., Balcells, L., Aldea, M., Casas, C., Herrero, E., Arino, J. (1996). "Sequence analysis of a 13.4 kbp fragment from the left arm of chromosome XV reveals a malate dehydrogenase gene, a putative Ser/Thr protein kinase, the ribosomal L25 gene and four new open reading frames." Yeast 12:1013-1020.8896265
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Wilkinson, M. L., Crary, S. M., Jackman, J. E., Grayhack, E. J., Phizicky, E. M. (2007). "The 2'-O-methyltransferase responsible for modification of yeast tRNA at position 4." RNA 13:404-413.17242307
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956