You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSulfate permease 2
Synonyms
  • High-affinity sulfate transporter 2
Gene NameSUL2
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in secondary active sulfate transmembrane transporter activity
Specific FunctionHigh affinity uptake of sulfate into the cell
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00005SulfateShow
GO Classification
Component
cell part
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
transporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
anion transmembrane transporter activity
inorganic anion transmembrane transporter activity
sulfate transmembrane transporter activity
secondary active sulfate transmembrane transporter activity
Process
ion transport
anion transport
inorganic anion transport
sulfate transport
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 12
LocusYLR092W
Gene Sequence>2682 bp ATGTCCAGGGAAGGTTATCCAAACTTTGAAGAGGTAGAAATTCCTGACTTTCAGGAAACT AACAACACCGTTCCAGATCTTGATGATTTAGAATTAGAGTATGACCAATATAAAAATAAT GAAAATAATGACACGTTTAATGATAAGGACTTAGAGAGCAATTCTGTAGCAAAGCACAAC GCAGTGAACAGCTCAAAGGGCGTAAAAGGCTCGAAGATTGACTACTTTAATCCTTCAGAT GTCTCGTTGTATGACAATTCCGTTTCCCAATTTGAAGAAACAACGGTATCGCTAAAAGAG TACTATGACCACAGTATACGATCTCATCTCACGGTGAAAGGAGCATGTAGTTATCTTAAG AGTGTTTTTCCCATCATCAACTGGCTACCACATTACAATTTTAGCTGGTTTACTGCGGAT CTTATTGCAGGAATTACCATTGGCTGTGTTCTCGTGCCGCAATCCATGTCATATGCACAA GTCGCCACGCTACCAGCGCAGTATGGGTTGTACTCCTCGTTTATTGGTGCTTACTCCTAC TCTTTTTTCGCTACATCAAAAGATGTTTGTATTGGGCCCGTGGCTGTCATGTCTTTGCAG ACCGCCAAAGTCATTGCGGATGTCACGGCAAAATATCCTGATGGAGATTCTGCCATAACT GGTCCCGTTATTGCAACGACTCTAGCGTTACTATGTGGTATCATTTCGGCAGCAGTTGGC TTCTTGCGTCTAGGGTTTCTTGTCGAACTGATTTCCTTAAATGCAGTCGCTGGATTTATG ACTGGATCCGCGTTTAATATCTTATGGGGTCAAGTTCCAGCACTAATGGGTTACAATAGT TTGGTTAACACGAGAGCTGCCACCTATAAAGTGGTCATAGAGACCTTGAAACATTTACCA GATACCAAACTGGACGCAGTTTTTGGGCTAATCCCGCTTTTCCTTCTTTATGTTTGGAAA TGGTGGTGCGGAACATATGGACCAAGGTTGAACGATAGATACAACTCCAAAAACCCAAGG TTACACAAAATTATCAAATGGACATATTTTTACGCTCAGGCTTCCAGAAATGGTATCATT ATTATTGTATTCACTTGTATTGGTTGGGCAATCACAAGAGGCAAATCTAAATCGGAGAGG CCCATCAGCATCCTAGGCTCAGTTCCATCCGGTTTGAAAGAAGTCGGGGTTTTCCATGTT CCACCAGGATTAATGTCTAAGCTTGGTCCAAATTTGCCTGCATCCATTATTGTGTTATTG TTGGAGCATATCGCTATTTCGAAGTCTTTTGGTAGAATCAACGACTATAAAGTCGTCCCC GACCAAGAATTGATTGCTATTGGTGTCTCGAACCTTTTAGGTACTTTCTTCAATGCTTAC CCAGCGACTGGTTCCTTTTCAAGGTCTGCTTTGAAGGCTAAATGTAATGTCCGTACGCCG TTATCTGGTTTGTTTTCGGGTTCATGTGTTCTTTTAGCATTATATTGTTTGACCGGCGCA TTCTTTTACATTCCAAAGGCTACCTTATCTGCAGTTATCATTCACGCTGTATCTGATCTT TTGGCCTCTTATCAAACTACCTGGAATTTCTGGAAGATGAATCCATTGGACTTCATCTGT TTCATTGTCACCGTCCTAATAACGGTATTTGCCTCTATTGAAGATGGTATTTATTTTGCC ATGTGCTGGTCATGTGCAATGCTCATTTTAAAAGTGGCTTTCCCAGCGGGAAAATTCTTG GGTCGTGTGGAAGTCGCTGAAGTTACTGATGCTTACGTCAGACCGGACTCCGATGTGGTT AGCTACGTGTCTGAAAATAACAATGGTATTTCCACTTTAGAAGATGGTGGTGAGGATGAC AAGGAAAGTTCCACCAAATACGTCACAAATTCCTCCAAGAAAATAGAAACAAACGTTCAA ACAAAGGGCTTTGATTCTCCATCTTCTTCGATTAGCCAGCCAAGGATAAAATACCATACT AAATGGATACCGTTTGATCATAAATACACAAGAGAATTGAACCCGGACGTTCAGATTCTC CCCCCACCAGACGGTGTTCTTGTTTATAGGCTATCAGAGAGCTACACCTATCTCAACTGT TCCAGACACTACAACATCATAACCGAAGAAGTTAAAAAAGTTACCAGACGTGGTCAATTA ATTCGCCACAGAAAAAAATCTGACCGTCCATGGAATGATCCTGGTCCATGGGAAGCACCT GCTTTCTTAAAGAATTTGAAATTCTGGAAGAAAAGGGAGAACGACCCTGAATCCATGGAA AACGCGCCCAGCACCTCAGTCGATGTTGAAAGAGATGACAGGCCATTGCTGAAAATACTA TGCTTAGACTTCTCACAAGTGGCACAGACAGACGCTACGGCTCTTCAATCATTGGTTGAT TTGAGAAAGGCCATAAATCAATATGCAGATAGGCAAGTTGAATTCCACTTTGTGGGTATC ATTTCACCATGGGTGAAGAGAGGTTTAATTAGCAGAGGATTTGGTACTCTGAACGAAGAA TACAGTGATGAATCCATTGTTGCCGGTCATACAAGTTATCACGTCGCCAGAGTACCTCAA GGCGAAGAAAATCCTGAAAAATATAGCGTTTATACCGCTTCAGGAACAAATCTACCTTTC TTCCATATCGATATCCCAGATTTTGCTAAATGGGATATCTAG
Protein Properties
Pfam Domain Function
Protein Residues893
Protein Molecular Weight99649.79688
Protein Theoretical pI6.65
Signalling Regions
  • None
Transmembrane Regions
  • 132-152
  • 164-184
  • 189-209
  • 222-242
  • 245-265
  • 306-326
  • 351-371
  • 400-420
  • 444-464
  • 484-504
  • 533-551
  • 560-580
Protein Sequence>Sulfate permease 2 MSREGYPNFEEVEIPDFQETNNTVPDLDDLELEYDQYKNNENNDTFNDKDLESNSVAKHN AVNSSKGVKGSKIDYFNPSDVSLYDNSVSQFEETTVSLKEYYDHSIRSHLTVKGACSYLK SVFPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSY SFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVG FLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLP DTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGII IIVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLL LEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTP LSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFIC FIVTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVV SYVSENNNGISTLEDGGEDDKESSTKYVTNSSKKIETNVQTKGFDSPSSSISQPRIKYHT KWIPFDHKYTRELNPDVQILPPPDGVLVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQL IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRENDPESMENAPSTSVDVERDDRPLLKIL CLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEE YSDESIVAGHTSYHVARVPQGEENPEKYSVYTASGTNLPFFHIDIPDFAKWDI
References
External Links
ResourceLink
Saccharomyces Genome Database SUL2
Uniprot IDQ12325
Uniprot NameSUL2_YEAST
GenBank Gene IDU53880
Genebank Protein ID1256894
General Reference
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Cherest, H., Davidian, J. C., Thomas, D., Benes, V., Ansorge, W., Surdin-Kerjan, Y. (1997). "Molecular characterization of two high affinity sulfate transporters in Saccharomyces cerevisiae." Genetics 145:627-635.9055073
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258