You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePutative thiosulfate sulfurtransferase YOR285W
SynonymsNot Available
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionInorganic ion transport and metabolism
Specific FunctionThiosulfate + cyanide = sulfite + thiocyanate
Cellular LocationMitochondrion
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00074CyanideShow
YMDB00114SulfiteShow
YMDB00303ThiosulfateShow
YMDB00391ThiocyanateShow
GO ClassificationNot Available
Gene Properties
Chromosome LocationNot Available
LocusYOR285W
Gene Sequence>420 bp ATGTGGAAGGCCGTGATGAATGCTTGGAATGGAACCGAGAGTCAAAGTAAGAATGTTTCA AATATTCAATCTTACAGTTTTGAAGACATGAAAAGAATCGTTGGAAAGCATGATCCTAAT GTGGTTTTGGTAGATGTTAGAGAACCATCTGAGTACTCGATTGTTCATATTCCTGCTTCC ATCAATGTGCCATATAGATCGCACCCTGACGCATTTGCCTTAGATCCTTTAGAATTTGAG AAACAGATTGGCATCCCAAAACCTGACAGTGCCAAGGAGCTAATATTTTATTGTGCTTCT GGCAAACGCGGGGGAGAAGCTCAAAAAGTCGCCTCCTCACATGGATATTCAAACACCTCA CTATATCCTGGCTCTATGAATGATTGGGTTTCTCATGGGGGTGATAAACTTGACTTATAG
Protein Properties
Pfam Domain Function
Protein Residues139
Protein Molecular Weight15413.2002
Protein Theoretical pI6.35
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Putative thiosulfate sulfurtransferase YOR285W MWKAVMNAWNGTESQSKNVSNIQSYSFEDMKRIVGKHDPNVVLVDVREPSEYSIVHIPAS INVPYRSHPDAFALDPLEFEKQIGIPKPDSAKELIFYCASGKRGGEAQKVASSHGYSNTS LYPGSMNDWVSHGGDKLDL
References
External Links
ResourceLink
Saccharomyces Genome Database YOR285W
Uniprot IDQ12305
Uniprot NameYO285_YEAST
GenBank Gene IDX89633
Genebank Protein ID1279709
General Reference
  • Cheret, G., Bernardi, A., Sor, F. (1996). "DNA sequence analysis of the VPH1-SNF2 region on chromosome XV of Saccharomyces cerevisiae." Yeast 12:1059-1064.8896271
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Zahedi, R. P., Sickmann, A., Boehm, A. M., Winkler, C., Zufall, N., Schonfisch, B., Guiard, B., Pfanner, N., Meisinger, C. (2006). "Proteomic analysis of the yeast mitochondrial outer membrane reveals accumulation of a subclass of preproteins." Mol Biol Cell 17:1436-1450.16407407