You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NametRNA 2'-phosphotransferase
SynonymsNot Available
Gene NameTPT1
Enzyme Class
Biological Properties
General FunctionInvolved in transferase activity, transferring phosphorus-containing groups
Specific FunctionCatalyzes the last step of tRNA splicing, the transfer of the splice junction 2'-phosphate from ligated tRNA to NAD to produce ADP-ribose 1''-2'' cyclic phosphate
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00110NADShow
YMDB00141ADP-ribose 1"-2" cyclic phosphate Show
YMDB00274NiacinamideShow
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
Process
RNA splicing
RNA splicing, via endonucleolytic cleavage and ligation
tRNA splicing, via endonucleolytic cleavage and ligation
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
RNA metabolic process
RNA processing
Gene Properties
Chromosome Locationchromosome 15
LocusYOL102C
Gene Sequence>693 bp ATGCGCCAGGTACTACAAAAAGATAAAAGGGATGTACAGCTTTCCAAAGCTTTATCATAT CTGCTTCGACATACAGCGGTGAAAGAAAAGTTGACTATTGACTCAAACGGTTATACACCG CTGAAAGAACTATTGTCTCATAATAGATTGAAAACTCATAAATGTACGGTGGATGATATC CATCGCATTGTTAAGGAAAATGACAAACAACGCTTTCATATAAAAACGTTAGGAGCGGAC GAAGAATGGATCTGTGCTACTCAGGGACATTCAATCAAATCGATTCAGCCATCAGATGAG GTTCTCGTACCAATTACTGAAGCGTCGCAGTTACCACAGGAACTAATTCATGGAACAAAT CTTCAATCTGTCATAAAGATTATTGAATCCGGAGCAATATCACCAATGAGTAGAAATCAT GTCCATTTATCGCCGGGGATGTTGCACGCGAAGGGAGTTATTAGTGGAATGCGTTCTTCA AGTAACGTCTATATTTTCATCGACTGCCATTCTCCATTATTCTTTCAAACTTTGAAAATG TTCAGGTCGCTCAATAATGTTTACTTAAGCAGCAGTATTCCCGTTGAATTGATCCAAAAA GTTGTAGTTAAAGGAAACTTGAAAGATGAGGAGAAGTTAGATACTTTAAGAAGAATTTTA CACGAAAGAAACATACCGCTCGAAAAGATATAA
Protein Properties
Pfam Domain Function
Protein Residues230
Protein Molecular Weight26196.19922
Protein Theoretical pI9.81
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>tRNA 2'-phosphotransferase MRQVLQKDKRDVQLSKALSYLLRHTAVKEKLTIDSNGYTPLKELLSHNRLKTHKCTVDDI HRIVKENDKQRFHIKTLGADEEWICATQGHSIKSIQPSDEVLVPITEASQLPQELIHGTN LQSVIKIIESGAISPMSRNHVHLSPGMLHAKGVISGMRSSSNVYIFIDCHSPLFFQTLKM FRSLNNVYLSSSIPVELIQKVVVKGNLKDEEKLDTLRRILHERNIPLEKI
References
External Links
ResourceLink
Saccharomyces Genome Database TPT1
Uniprot IDQ12272
Uniprot NameTPT1_YEAST
GenBank Gene IDZ48149
Genebank Protein ID663252
General Reference
  • Vandenbol, M., Durand, P., Portetelle, D., Hilger, F. (1995). "Sequence analysis of a 44 kb DNA fragment of yeast chromosome XV including the Tyl-H3 retrotransposon, the suf1(+) frameshift suppressor gene for tRNA-Gly, the yeast transfer RNA-Thr-1a and a delta element." Yeast 11:1069-1075.7502582
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Culver, G. M., McCraith, S. M., Consaul, S. A., Stanford, D. R., Phizicky, E. M. (1997). "A 2'-phosphotransferase implicated in tRNA splicing is essential in Saccharomyces cerevisiae." J Biol Chem 272:13203-13210.9148937
  • Spinelli, S. L., Kierzek, R., Turner, D. H., Phizicky, E. M. (1999). "Transient ADP-ribosylation of a 2'-phosphate implicated in its removal from ligated tRNA during splicing in yeast." J Biol Chem 274:2637-2644.9915792
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106