You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePutative cystathionine gamma-synthase YLL058W
Synonyms
  • O-succinylhomoserine (thiol)-lyase
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionInvolved in pyridoxal phosphate binding
Specific FunctionO(4)-succinyl-L-homoserine + L-cysteine = L- cystathionine + succinate
Cellular LocationNot Available
SMPDB Pathways
Selenocompound metabolismPW002472 ThumbThumb?image type=greyscaleThumb?image type=simple
Sulfur metabolismPW002483 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Cysteine and methionine metabolismec00270 Map00270
Selenocompound metabolismec00450 Map00450
Sulfur metabolismec00920 Map00920
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00046L-CysteineShow
YMDB00245L-CystathionineShow
YMDB00338Succinic acidShow
YMDB00917O-Succinyl-L-homoserineShow
GO Classification
Component
Not Available
Function
catalytic activity
binding
cofactor binding
pyridoxal phosphate binding
Process
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
Gene Properties
Chromosome LocationNot Available
LocusYLL058W
Gene Sequence>1728 bp ATGACGGAAATTGAATTTGGGCAACCCCTTCCCAGCAATCTAGACTATGCTGTTTCTTTT GGCATTCCTACATGGGATTCGGCAATAGGCTATGCGGAAAAGGTGCCAGAGGTAATAGGC AAAATGGCTACAGGATATCCGAGGTACTTTCCTCAACCCCCCGTCCAGAGGCTTTGTGCT TACTTTGTTAAGAAATTTGGGCGAGGTTCAGAAAACTGTCGTCCTTTTCCATCCGTTAAC CTGGGTTTAAAGTGTTTCGAGTACGTAAAATCTGTCTCAGGACCTGAAAGTAAAGCTCAC CTTGAAGTGGAAACAGTTACGATTAAAAACCGTGGGGCAAAAACGTCGAAAGAACCGGCG GAATTGGTGCTAACCATTGCTGCTGTCCTTGCATCGGAGGAAGAGTTCGAGACTGTGAAA GAGTATTGGAAATTAAGAGGTGAATGTGTATCTAGTCGATTGGCGTTGTCTGTCAACCAA CTTCTTGACTGCGCTAATCATGGCTCAGAGCAGGTATTGCGTGAGCTAGAGGCTGGTGTT TTTGCAGCAAAGAAGGGGGAGGAGAAAGCAAAGAACCTGATAAAGGGAAGGATAGTTGAG AATCGCTTCAGGCCCTTTGGTTTGGAGAAGAAAACCCCGAATTGGGAGGGACTCAACCTC AACCCAAATGAAGACGTTTATCTTGTATCAAGTGGCATGTCTGCAATATCTACGGCTCGT AATTTACTCACCTTTTGGGAGGAGAAGAAGAATTCAGGAGATTCATTAAACAAGACCACC TCTGACCAAAAGAAAAAGCCATTATTATGTGACACTGTTGGCATCTTCGGCTTCCCTTTC AAAGATACGCAGGTCATTATGACTAAATTTGGAAAATGTAAATTTTTTGGATTTGGAAAT TCTAGAGACGTTGTCGAATTACAAAAGTTTTTAGAAACAAGCAAACAACGCATTCTTGCC GTTTTCGTCGAGACACCTTCAAATCCTCTGCTGAATATGCCGGATTTGAAAAAATTGAGG AGTTTGGCCGACCAGTATGGCTTTTTTATTGTAATTGATGATACTATTGGGGGCCTTAAC GTTGACATCTTGCCCTATGCTGATATAGTCAGCACGTCCCTGACTAAGCTTTTCAATGGT GCTAGTAATGTAATGGGCGGCTCTGTCGTTTTAAATCCGAAATCATCTCTGTATCCATAT GCTCGTGAGTACTTCAGGAGCGCTAATTTCGAGGATTTGTTATGGTGTGAAGATGCGATA GTTTTAGAACGTAATTCCAGGGATTTTGAAGATAGAACTTTACGTGCTAATGCAAACACA GGAATATTGTTGAATGATTTGCTTTTACCCGAGGAGGGGAAAATATGCAAAAAGATTTAT TATCCAACTGTTACTTCTAAGGAGACCTTTGAGAACTACGAAAGTGTACGTAATGAACGT GGTGGCTATGGATGCTTGTTCTCTGTAGCCTTTTTCAATGAGGGCGATGCAAAAGCATTC TATGACTCTTTAAAGGTATTCAAGGGACCTTCTAATGGTACTAACTTTACCTTAGCATGT CCATATGTCCATCTGGCGCACCACTCAGAATTAGAAGAAGTTTCCAAGTTTGGGGCCGAC CCCAACATTATTAGAGTAAGCGTAGGTTTAGAAGATATCCAGTGGTTATTGAAAGTTTTT TCAAGTGCTTTAGATGTTGTGAAAAGCAGAGGCTCCAAACACTCATGA
Protein Properties
Pfam Domain Function
Protein Residues575
Protein Molecular Weight64222.80078
Protein Theoretical pI7.04
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Putative cystathionine gamma-synthase YLL058W MTEIEFGQPLPSNLDYAVSFGIPTWDSAIGYAEKVPEVIGKMATGYPRYFPQPPVQRLCA YFVKKFGRGSENCRPFPSVNLGLKCFEYVKSVSGPESKAHLEVETVTIKNRGAKTSKEPA ELVLTIAAVLASEEEFETVKEYWKLRGECVSSRLALSVNQLLDCANHGSEQVLRELEAGV FAAKKGEEKAKNLIKGRIVENRFRPFGLEKKTPNWEGLNLNPNEDVYLVSSGMSAISTAR NLLTFWEEKKNSGDSLNKTTSDQKKKPLLCDTVGIFGFPFKDTQVIMTKFGKCKFFGFGN SRDVVELQKFLETSKQRILAVFVETPSNPLLNMPDLKKLRSLADQYGFFIVIDDTIGGLN VDILPYADIVSTSLTKLFNGASNVMGGSVVLNPKSSLYPYAREYFRSANFEDLLWCEDAI VLERNSRDFEDRTLRANANTGILLNDLLLPEEGKICKKIYYPTVTSKETFENYESVRNER GGYGCLFSVAFFNEGDAKAFYDSLKVFKGPSNGTNFTLACPYVHLAHHSELEEVSKFGAD PNIIRVSVGLEDIQWLLKVFSSALDVVKSRGSKHS
References
External Links
ResourceLink
Saccharomyces Genome Database YLL058W
Uniprot IDQ12198
Uniprot NameMETW_YEAST
GenBank Gene IDZ47973
Genebank Protein ID642326
General Reference
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106