Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSpermidine synthase
Synonyms
  • SPDSY
  • Putrescine aminopropyltransferase
Gene NameSPE3
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionS-adenosylmethioninamine + putrescine = 5'-S- methyl-5'-thioadenosine + spermidine
Cellular LocationNot Available
SMPDB Pathways
Glutathione metabolismPW002395 ThumbThumb?image type=greyscaleThumb?image type=simple
beta-Alanine metabolismPW002381 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Arginine and proline metabolismec00330 Map00330
Cysteine and methionine metabolismec00270 Map00270
Glutathione metabolismec00480 Map00480
beta-Alanine metabolismec00410 Map00410
SMPDB Reactions
Putrescine + S-Adenosylmethioninaminehydron + 5'-Methylthioadenosine + Spermidine
KEGG Reactions
Putrescine + S-AdenosylmethioninamineSpermidine + hydron + 5'-Methylthioadenosine
Metabolites
YMDB IDNameView
YMDB00130S-AdenosylmethioninamineShow
YMDB00132PutrescineShow
YMDB001785'-MethylthioadenosineShow
YMDB00232SpermidineShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
catalytic activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 16
LocusYPR069C
Gene Sequence>882 bp ATGGCACAAGAAATCACTCACCCAACTATTGTAGACGGCTGGTTCAGAGAAATTTCTGAT ACCATGTGGCCAGGCCAGGCCATGACTTTAAAAGTGGAGAAAGTTTTACACCATGAGAAG TCAAAATATCAAGACGTTTTGATCTTCAAATCCACTACATATGGTAATGTTCTAGTTTTA GATAATGTAATTCAAGCCACCGAAAGGGATGAATTTGCCTACCAAGAAATGATTGCCCAT CTTGCCTTGAATTCCCATCCAAATCCTAAGAAGGTTCTTGTTATTGGTGGGGGTGATGGT GGTGTTTTGAGAGAGGTTGTCAAGCATGATTCCGTTGAGGAAGCCTGGTTATGTGACATT GATGAAGCTGTTATTAGACTATCAAAGGAGTACCTACCAGAAATGGCTGCCTCTTATTCT CACCCAAAGGTTAAGACCCACATTGGTGATGGTTTCCAATTTTTAAGAGATTACCAAAAC ACATTTGACGTAATCATTACTGACTCTTCTGACCCAGAAGGTCCAGCTGAAACCCTTTTC CAAAAGGAATATTTCCAATTGTTGAACAGTGCGTTGACAGAAAAGGGTGTAATCACTACA CAAGCAGAAAGTATGTGGATTCACTTGCCAATCATTAAGGACTTAAAGAAAGCCTGTTCT GAAGTTTTCCCAGTTGCAGAATACTCTTTCGTTACTATTCCAACTTACCCAACTGGTACG ATTGGTTTTATGGTTTGCTCCAAAGATAAAACTTGCAATGTCAAGAAGCCACTACGTGAA ATCTCTGATGAGAAGGAGGCTGAATTATACAGATACTATAACAAGAAAATTCACGAAGCT TCCTTTGTTCTACCAACCTGGGCAGCCAAGGAATTAAATTAG
Protein Properties
Pfam Domain Function
Protein Residues293
Protein Molecular Weight33323.80078
Protein Theoretical pI5.24
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Spermidine synthase MAQEITHPTIVDGWFREISDTMWPGQAMTLKVEKVLHHEKSKYQDVLIFKSTTYGNVLVL DNVIQATERDEFAYQEMIAHLALNSHPNPKKVLVIGGGDGGVLREVVKHDSVEEAWLCDI DEAVIRLSKEYLPEMAASYSHPKVKTHIGDGFQFLRDYQNTFDVIITDSSDPEGPAETLF QKEYFQLLNSALTEKGVITTQAESMWIHLPIIKDLKKACSEVFPVAEYSFVTIPTYPTGT IGFMVCSKDKTCNVKKPLREISDEKEAELYRYYNKKIHEASFVLPTWAAKELN
References
External Links
ResourceLink
Saccharomyces Genome Database SPE3
Uniprot IDQ12074
Uniprot NameSPEE_YEAST
GenBank Gene IDU27519
Genebank Protein ID1326074
General Reference
  • Hamasaki-Katagiri, N., Tabor, C. W., Tabor, H. (1997). "Spermidine biosynthesis in Saccharomyces cerevisae: polyamine requirement of a null mutant of the SPE3 gene (spermidine synthase)." Gene 187:35-43.9073064
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875