You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameS-adenosylmethionine permease SAM3
Synonyms
  • S-adenosylmethionine metabolism protein 3
Gene NameSAM3
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transport
Specific FunctionHigh-affinity S-adenosylmethionine permease, required for utilization of S-adenosylmethionine as a sulfur source
Cellular LocationMembrane; Multi-pass membrane protein. Endoplasmic reticulum
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00232SpermidineShow
YMDB00438S-Adenosyl-L-methionineShow
YMDB00862hydronShow
GO Classification
Component
intrinsic to membrane
integral to membrane
cell part
membrane
membrane part
Function
transporter activity
transmembrane transporter activity
active transmembrane transporter activity
amine transmembrane transporter activity
amino acid transmembrane transporter activity
Process
transport
amine transport
amino acid transport
transmembrane transport
establishment of localization
Gene Properties
Chromosome Locationchromosome 16
LocusYPL274W
Gene Sequence>1764 bp ATGGATATACTCAAGAGGGGAAATGAATCGGACAAGTTTACGAAAATAGAGACAGAATCT ACTACGATACCAAATGACTCGGATAGATCTGGTTCACTGATCAGAAGAATGAAGGATTCC TTCAAGCAAAGTAACCTGCATGTCATTCCAGAAGACCTTGAAAACAGCGAACAGACAGAG CAGGAAAAAATCCAATGGAAACTAGCTTCTCAGCCCTATCAAAAAGTCTTGAGCCAAAGG CACTTGACCATGATTGCCATAGGTGGTACTTTGGGGACGGGACTGTTCATTGGTTTAGGT TATTCTTTGGCATCTGGGCCAGCCGCTTTGCTAATCGGTTTTTTGTTAGTTGGTACTTCA ATGTTCTGTGTCGTTCAGAGTGCCGCAGAGCTTTCCTGCCAATTCCCGGTTTCTGGCTCA TATGCCACACATGTCAGTAGGTTCATAGATGAATCGGTTGGCTTTACTGTGGCTACAAAC TATGCTTTGGCTTGGCTGATTTCTTTTCCAAGCGAATTAATTGGTTGTGCACTTACTATT TCATACTGGAACCAAACGGTTAATCCGGCTGTTTGGGTGGCCATTTTTTATGTTTTCATT ATGGTACTGAACTTGTTTGGTGTGAGAGGCTTTGCCGAGACTGAGTTTGCTCTGTCAATC ATTAAGGTTATTGCTATATTTATTTTCATCATTATTGGTATCGTCCTTATTGCCGGAGGG GGGCCTAACTCTACTGGTTATATTGGCGCCAAATACTGGCACGACCCAGGTGCCTTCGCA AAACCTGTCTTCAAGAATTTGTGTAACACATTCGTTTCTGCTGCTTTTTCCTTTGGTGGT AGTGAGTTAGTGCTGTTAACTAGTACAGAATCTAAAAATATTTCAGCTATATCACGTGCT GCCAAAGGTACGTTCTGGAGAATCGCGATTTTTTACATTACTACCGTTGTCATTATTGGA TGTCTCGTACCTTATAACGACCCCAGACTGCTCAGTGGTTCGAACAGTGAGGATGTATCT GCCTCTCCCTTTGTTATTGCTTTGAGTAATACAGGATCAATGGGTGCAAAAGTTTCCAAC TTTATGAATGTCGTTATCCTTGTTGCGGTTGTGTCAGTTTGCAATTCTTGCGTTTATGCT TCTTCAAGACTAATTCAAGCTTTAGGTGCATCTGGCCAACTTCCTTCGGTATGTTCCTAC ATGGACAGAAAGGGTAGGCCTTTGGTTGGCATTGGGATTAGTGGTGCATTTGGTCTTTTA GGTTTTCTTGTGGCCTCGAAAAAGGAGGACGAGGTCTTCACTTGGCTTTTCGCCCTTTGT TCCATTTCATCATTCTTCACCTGGTTCTGTATTTGTATGTCACAAATTAGATTTAGGATG GCTTTGAAAGCTCAAGGAAGATCCAATGACGAAATAGCTTACAAATCCATACTGGGTGTT TATGGTGGAATTTTGGGGTGTGTGCTAAATGCATTGCTAATTGCGGGTGAAATATACGTA TCGGCCGCCCCGGTCGGTAGCCCTAGCTCCGCTGAAGCCTTCTTTGAATACTGTTTAAGT ATTCCAATCATGATTGTTGTTTATTTTGCACATAGGTTTTATCGAAGAGATTGGAAACAC TTCTACATCAAGAGGAGTGAGATCGATCTGGATACTGGGTGTTCCGTGGAGAATCTAGAG CTTTTCAAAGCACAAAAAGAAGCTGAGGAACAACTCATTGCTTCTAAGCCATTCTATTAC AAAATCTACAGATTTTGGTGTTAG
Protein Properties
Pfam Domain Function
Protein Residues587
Protein Molecular Weight64353.0
Protein Theoretical pI7.88
Signalling Regions
  • None
Transmembrane Regions
  • 81-103
  • 110-129
  • 163-183
  • 187-207
  • 220-240
  • 267-287
  • 303-323
  • 361-381
  • 407-427
  • 432-452
  • 476-496
  • 510-530
Protein Sequence>S-adenosylmethionine permease SAM3 MDILKRGNESDKFTKIETESTTIPNDSDRSGSLIRRMKDSFKQSNLHVIPEDLENSEQTE QEKIQWKLASQPYQKVLSQRHLTMIAIGGTLGTGLFIGLGYSLASGPAALLIGFLLVGTS MFCVVQSAAELSCQFPVSGSYATHVSRFIDESVGFTVATNYALAWLISFPSELIGCALTI SYWNQTVNPAVWVAIFYVFIMVLNLFGVRGFAETEFALSIIKVIAIFIFIIIGIVLIAGG GPNSTGYIGAKYWHDPGAFAKPVFKNLCNTFVSAAFSFGGSELVLLTSTESKNISAISRA AKGTFWRIAIFYITTVVIIGCLVPYNDPRLLSGSNSEDVSASPFVIALSNTGSMGAKVSN FMNVVILVAVVSVCNSCVYASSRLIQALGASGQLPSVCSYMDRKGRPLVGIGISGAFGLL GFLVASKKEDEVFTWLFALCSISSFFTWFCICMSQIRFRMALKAQGRSNDEIAYKSILGV YGGILGCVLNALLIAGEIYVSAAPVGSPSSAEAFFEYCLSIPIMIVVYFAHRFYRRDWKH FYIKRSEIDLDTGCSVENLELFKAQKEAEEQLIASKPFYYKIYRFWC
References
External Links
ResourceLink
Saccharomyces Genome Database SAM3
Uniprot IDQ08986
Uniprot NameSAM3_YEAST
GenBank Gene IDZ73630
Genebank Protein ID1370565
General Reference
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Rouillon, A., Surdin-Kerjan, Y., Thomas, D. (1999). "Transport of sulfonium compounds. Characterization of the s-adenosylmethionine and s-methylmethionine permeases from the yeast Saccharomyces cerevisiae." J Biol Chem 274:28096-28105.10497160
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258