You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameFormate dehydrogenase 1
Synonyms
  • NAD-dependent formate dehydrogenase 1
Gene NameFDH1
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
Specific FunctionFormate + NAD(+) = CO(2) + NADH
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG Pathways
Glyoxylate and dicarboxylate metabolismec00630 Map00630
Methane metabolismec00680 Map00680
SMPDB ReactionsNot Available
KEGG Reactions
NAD + Formic acidNADH + Carbon dioxide
Metabolites
YMDB IDNameView
YMDB00110NADShow
YMDB00143NADHShow
YMDB00385Formic acidShow
YMDB00412NAD(+)Show
YMDB00912Carbon dioxideShow
GO Classification
Component
Not Available
Function
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
NAD or NADH binding
catalytic activity
binding
nucleotide binding
oxidoreductase activity
cofactor binding
oxidoreductase activity, acting on CH-OH group of donors
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOR388C
Gene Sequence>1131 bp ATGTCGAAGGGAAAGGTTTTGCTGGTTCTTTACGAAGGTGGTAAGCATGCTGAAGAGCAG GAAAAGTTATTGGGGTGTATTGAAAATGAACTTGGTATCAGAAATTTCATTGAAGAACAG GGATACGAGTTGGTTACTACCATTGACAAGGACCCTGAGCCAACCTCAACGGTAGACAGG GAGTTGAAAGACGCTGAAATTGTCATTACTACGCCCTTTTTCCCCGCCTACATCTCGAGA AACAGGATTGCAGAAGCTCCTAACCTGAAGCTCTGTGTAACCGCTGGCGTCGGTTCAGAC CATGTCGATTTAGAAGCTGCAAATGAACGGAAAATCACGGTCACCGAAGTTACTGGTTCT AACGTCGTTTCTGTCGCAGAGCACGTTATGGCCACAATTTTGGTTTTGATAAGAAACTAT AATGGTGGTCATCAACAAGCAATTAATGGTGAGTGGGATATTGCCGGCGTGGCTAAAAAT GAGTATGATCTGGAAGACAAAATAATTTCAACGGTAGGTGCCGGTAGAATTGGATATAGG GTTCTGGAAAGATTGGTCGCATTTAATCCGAAGAAGTTACTGTACTACGACTACCAGGAA CTACCTGCGGAAGCAATCAATAGATTGAACGAGGCCAGCAAGCTTTTCAATGGCAGAGGT GATATTGTTCAGAGAGTAGAGAAATTGGAGGATATGGTTGCTCAGTCAGATGTTGTTACC ATCAACTGTCCATTGCACAAGGACTCAAGGGGTTTATTCAATAAAAAGCTTATTTCCCAC ATGAAAGATGGTGCATACTTGGTGAATACCGCTAGAGGTGCTATTTGTGTCGCAGAAGAT GTTGCCGAGGCAGTCAAGTCTGGTAAATTGGCTGGCTATGGTGGTGATGTCTGGGATAAG CAACCAGCACCAAAAGACCATCCCTGGAGGACTATGGACAATAAGGACCACGTGGGAAAC GCAATGACTGTTCATATCAGTGGCACATCTCTGGATGCTCAAAAGAGGTACGCTCAGGGA GTAAAGAACATCCTAAATAGTTACTTTTCCAAAAAGTTTGATTACCGTCCACAGGATATT ATTGTGCAGAATGGTTCTTATGCCACCAGAGCTTATGGACAGAAGAAATAA
Protein Properties
Pfam Domain Function
Protein Residues376
Protein Molecular Weight41714.0
Protein Theoretical pI6.43
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Formate dehydrogenase 1 MSKGKVLLVLYEGGKHAEEQEKLLGCIENELGIRNFIEEQGYELVTTIDKDPEPTSTVDR ELKDAEIVITTPFFPAYISRNRIAEAPNLKLCVTAGVGSDHVDLEAANERKITVTEVTGS NVVSVAEHVMATILVLIRNYNGGHQQAINGEWDIAGVAKNEYDLEDKIISTVGAGRIGYR VLERLVAFNPKKLLYYDYQELPAEAINRLNEASKLFNGRGDIVQRVEKLEDMVAQSDVVT INCPLHKDSRGLFNKKLISHMKDGAYLVNTARGAICVAEDVAEAVKSGKLAGYGGDVWDK QPAPKDHPWRTMDNKDHVGNAMTVHISGTSLDAQKRYAQGVKNILNSYFSKKFDYRPQDI IVQNGSYATRAYGQKK
References
External Links
ResourceLink
Saccharomyces Genome Database FDH1
Uniprot IDQ08911
Uniprot NameFDH1_YEAST
GenBank Gene IDZ75296
Genebank Protein ID1420835
General Reference
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • van den Berg, M. A., Steensma, H. Y. (1997). "Expression cassettes for formaldehyde and fluoroacetate resistance, two dominant markers in Saccharomyces cerevisiae." Yeast 13:551-559.9178506
  • Overkamp, K. M., Kotter, P., van der Hoek, R., Schoondermark-Stolk, S., Luttik, M. A., van Dijken, J. P., Pronk, J. T. (2002). "Functional analysis of structural genes for NAD(+)-dependent formate dehydrogenase in Saccharomyces cerevisiae." Yeast 19:509-520.11921099