You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePutative thiosulfate sulfurtransferase FMP31, mitochondrial
Synonyms
  • Found in mitochondrial proteome protein 31
Gene NameFMP31
Enzyme Class
Biological Properties
General FunctionInorganic ion transport and metabolism
Specific FunctionThiosulfate + cyanide = sulfite + thiocyanate
Cellular LocationMitochondrion
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00074CyanideShow
YMDB00114SulfiteShow
YMDB00303ThiosulfateShow
YMDB00391ThiocyanateShow
GO ClassificationNot Available
Gene Properties
Chromosome LocationNot Available
LocusYOR286W
Gene Sequence>450 bp ATGTTCAAGCATAGTACAGGTATTCTCTCGAGGACAGTTTCTGCAAGATCGCCTACATTG GTCCTGAGAACATTTACAACGAAGGCTCCAAAGATCTATACTTTTGACCAGGTCAGGAAC CTAGTCGAACACCCCAATGATAAAAAACTATTGGTAGATGTAAGGGAACCCAAGGAAGTA AAGGATTACAAGATGCCAACTACAATAAATATTCCGGTGAATAGTGCCCCTGGCGCTCTT GGATTGCCCGAAAAGGAGTTTCACAAAGTTTTCCAATTTGCTAAACCACCTCACGATAAA GAATTGATTTTTCTTTGTGCGAAAGGAGTAAGAGCCAAAACTGCCGAAGAGTTGGCTCGA TCTTATGGGTACGAAAACACTGGTATCTATCCTGGTTCTATTACTGAGTGGTTAGCTAAA GGTGGTGCTGACGTTAAGCCCAAAAAATAA
Protein Properties
Pfam Domain Function
Protein Residues149
Protein Molecular Weight16697.19922
Protein Theoretical pI10.26
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Putative thiosulfate sulfurtransferase FMP31, mitochondrial MFKHSTGILSRTVSARSPTLVLRTFTTKAPKIYTFDQVRNLVEHPNDKKLLVDVREPKEV KDYKMPTTINIPVNSAPGALGLPEKEFHKVFQFAKPPHDKELIFLCAKGVRAKTAEELAR SYGYENTGIYPGSITEWLAKGGADVKPKK
References
External Links
ResourceLink
Saccharomyces Genome Database FMP31
Uniprot IDQ08742
Uniprot NameFMP31_YEAST
GenBank Gene IDAY692684
Genebank Protein ID51012819
General Reference
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Sickmann, A., Reinders, J., Wagner, Y., Joppich, C., Zahedi, R., Meyer, H. E., Schonfisch, B., Perschil, I., Chacinska, A., Guiard, B., Rehling, P., Pfanner, N., Meisinger, C. (2003). "The proteome of Saccharomyces cerevisiae mitochondria." Proc Natl Acad Sci U S A 100:13207-13212.14576278