You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameLysophospholipid acyltransferase
Synonyms
  • LPLAT
  • 1-acyl-sn-glycerol-3-phosphate acyltransferase
  • AGPAT
  • Lysophosphatidic acid acyltransferase
  • LPAAT
  • Lysophosphatidylcholine acyltransferase
  • LPCAT
  • Lysophosphatidylethanolamine acyltransferase
  • LPEAT
Gene NameALE1
Enzyme Class
Biological Properties
General FunctionInvolved in 1-acylglycerol-3-phosphate O-acyltransferas
Specific FunctionMembrane-bound O-acyltransferase that mediates the incorporation of unsaturated acyl chains into the sn-2 position of phopholipids. Preferentially acylates lysophosphocholine, but also lysophosphoethanolamine and lysophosphatidylglycerol
Cellular LocationEndoplasmic reticulum membrane; Multi-pass membrane protein. Microsome membrane; Multi-pass membrane protein
SMPDB Pathways
Cardiolipin BiosynthesisPW002431 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/10:0/28:0)PW003484 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/10:0/30:0)PW003501 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/12:0/26:0)PW003502 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/12:0/28:0)PW003503 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycerolipid metabolismec00561 Map00561
Glycerophospholipid metabolismec00564 Map00564
SMPDB Reactions
PA(16:0/0:0) + Palmityl-CoACoenzyme A + PA(10:0/16:0)
PA(16:0/0:0) + Palmityl-CoACoenzyme A + PA(10:0/16:1(11Z))
PA(16:0/0:0) + Palmityl-CoACoenzyme A + PA(10:0/16:1(9Z))
PA(16:0/0:0) + Palmityl-CoACoenzyme A + PA(10:0/18:0)
PA(16:0/0:0) + Palmityl-CoACoenzyme A + PA(10:0/18:1(11Z))
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00069Palmitic acidShow
YMDB00301Palmityl-CoAShow
YMDB00539oleoyl-CoAShow
YMDB01127DG(16:0/16:0/0:0)Show
YMDB01160PA(16:0/0:0)Show
YMDB01161PA(16:0/16:0)Show
YMDB163021-oleyl-2-lyso-phosphatidateShow
GO ClassificationNot Available
Gene Properties
Chromosome Locationchromosome 15
LocusYOR175C
Gene Sequence>1860 bp ATGTACAATCCTGTGGACGCTGTTTTAACAAAGATAATTACCAACTATGGGATTGATAGT TTTACACTGCGATATGCTATCTGCTTATTGGGATCGTTCCCACTGAATGCTATTTTGAAG AGAATTCCCGAGAAGCGTATAGGTTTAAAATGTTGTTTTATCATTTCTATGTCGATGTTT TACTTATTCGGTGTGCTGAATCTAGTAAGTGGATTCAGGACCCTGTTTATTAGTACCATG TTTACTTACTTGATCTCAAGATTTTACCGTTCCAAGTTTATGCCACACTTGAATTTCATG TTTGTTATGGGTCATTTGGCAATAAATCATATACACGCCCAATTCCTTAACGAACAGACT CAAACTACCGTTGACATTACAAGTTCACAAATGGTTTTAGCCATGAAACTAACTTCTTTT GCATGGTCGTACTATGATGGTTCATGCACTAGCGAAAGCGATTTCAAAGATTTGACTGAG CATCAAAAATCTCGTGCTGTCAGAGGTCATCCACCCTTATTAAAGTTCCTGGCATATGCA TTTTTCTATTCAACGTTGCTAACTGGCCCAAGTTTCGATTATGCCGATTTTGACAGCTGG TTGAATTGTGAGATGTTCCGTGACTTGCCTGAAAGCAAAAAGCCTATGAGAAGACACCAC CCTGGTGAAAGAAGACAGATTCCAAAGAATGGTAAACTTGCATTATGGAAAGTTGTTCAA GGTCTTGCTTGGATGATTTTAAGTACACTAGGAATGAAGCACTTCCCCGTAAAATACGTT TTGGACAAAGATGGCTTCCCAACGAGATCTTTTATATTCAGAATCCATTACTTATTCTTG CTTGGTTTCATCCATAGATTCAAGTACTACGCTGCCTGGACTATTTCGGAAGGATCTTGT ATTTTGTGCGGTTTGGGTTATAATGGTTATGATTCAAAGACACAAAAGATCAGATGGGAT CGTGTCAGAAATATTGACATTTGGACCGTAGAAACGGCGCAGAATACGCGTGAAATGTTG GAAGCATGGAATATGAATACTAACAAGTGGCTAAAATACTCTGTTTATTTACGTGTCACA AAGAAGGGCAAAAAACCTGGTTTCCGCTCAACTTTGTTTACTTTCCTAACTTCCGCATTT TGGCATGGTACCAGACCTGGGTACTATCTGACTTTTGCGACAGGGGCTTTGTACCAAACA TGTGGTAAAATCTACAGACGCAATTTTAGACCAATTTTCTTGCGAGAAGATGGTGTCACT CCTTTGCCTTCTAAAAAAATCTACGATTTAGTTGGCATATATGCAATTAAACTAGCATTT GGTTACATGGTGCAACCATTTATTATCCTTGATTTGAAGCCATCTTTAATGGTATGGGGC TCTGTTTATTTCTATGTTCATATTATTGTTGCTTTCTCATTTTTCCTATTCAGAGGACCA TATGCTAAACAAGTTACTGAATTTTTTAAATCCAAACAACCTAAAGAAATATTCATTAGA AAACAAAAGAAGTTGGAAAAAGATATTTCTGCAAGCTCTCCAAACTTGGGTGGTATATTG AAGGCAAAGATTGAACATGAAAAGGGAAAGACAGCAGAAGAAGAAGAAATGAACTTAGGT ATTCCACCAATTGAGTTAGAAAAGTGGGACAATGCTAAGGAAGATTGGGAAGATTTCTGC AAAGATTACAAAGAATGGAGAAATAAAAATGGTCTTGAAATAGAAGAGGAAAACCTTTCT AAAGCTTTTGAAAGATTCAAGCAGGAATTTTCTAACGCTGCAAGTGGATCAGGTGAACGT GTGAGAAAAATGAGTTTTAGTGGTTACTCACCAAAGCCTATTTCAAAAAAGGAAGAGTAG
Protein Properties
Pfam Domain Function
Protein Residues619
Protein Molecular Weight72227.39844
Protein Theoretical pI9.94
Signalling Regions
  • None
Transmembrane Regions
  • 20-39
  • 52-72
  • 93-113
  • 232-252
  • 275-295
  • 430-450
  • 457-477
Protein Sequence>Lysophospholipid acyltransferase MYNPVDAVLTKIITNYGIDSFTLRYAICLLGSFPLNAILKRIPEKRIGLKCCFIISMSMF YLFGVLNLVSGFRTLFISTMFTYLISRFYRSKFMPHLNFMFVMGHLAINHIHAQFLNEQT QTTVDITSSQMVLAMKLTSFAWSYYDGSCTSESDFKDLTEHQKSRAVRGHPPLLKFLAYA FFYSTLLTGPSFDYADFDSWLNCEMFRDLPESKKPMRRHHPGERRQIPKNGKLALWKVVQ GLAWMILSTLGMKHFPVKYVLDKDGFPTRSFIFRIHYLFLLGFIHRFKYYAAWTISEGSC ILCGLGYNGYDSKTQKIRWDRVRNIDIWTVETAQNTREMLEAWNMNTNKWLKYSVYLRVT KKGKKPGFRSTLFTFLTSAFWHGTRPGYYLTFATGALYQTCGKIYRRNFRPIFLREDGVT PLPSKKIYDLVGIYAIKLAFGYMVQPFIILDLKPSLMVWGSVYFYVHIIVAFSFFLFRGP YAKQVTEFFKSKQPKEIFIRKQKKLEKDISASSPNLGGILKAKIEHEKGKTAEEEEMNLG IPPIELEKWDNAKEDWEDFCKDYKEWRNKNGLEIEEENLSKAFERFKQEFSNAASGSGER VRKMSFSGYSPKPISKKEE
References
External Links
ResourceLink
Saccharomyces Genome Database ALE1
Uniprot IDQ08548
Uniprot NameALE1_YEAST
GenBank Gene IDZ75083
Genebank Protein ID1420425
General Reference
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Madania, A., Poch, O., Tarassov, I., Winsor, B., Martin, R. (1996). "Analysis of a 22,956 bp region on the right arm of Saccharomyces cerevisiae chromosome XV." Yeast 12:1563-1573.8972579
  • Hofmann, K. (2000). "A superfamily of membrane-bound O-acyltransferases with implications for wnt signaling." Trends Biochem Sci 25:111-112.10694878
  • Ficarro, S. B., McCleland, M. L., Stukenberg, P. T., Burke, D. J., Ross, M. M., Shabanowitz, J., Hunt, D. F., White, F. M. (2002). "Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae." Nat Biotechnol 20:301-305.11875433
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Chen, Q., Kazachkov, M., Zheng, Z., Zou, J. (2007). "The yeast acylglycerol acyltransferase LCA1 is a key component of Lands cycle for phosphatidylcholine turnover." FEBS Lett 581:5511-5516.17996202
  • Riekhof, W. R., Wu, J., Jones, J. L., Voelker, D. R. (2007). "Identification and characterization of the major lysophosphatidylethanolamine acyltransferase in Saccharomyces cerevisiae." J Biol Chem 282:28344-28352.17652094
  • Jain, S., Stanford, N., Bhagwat, N., Seiler, B., Costanzo, M., Boone, C., Oelkers, P. (2007). "Identification of a novel lysophospholipid acyltransferase in Saccharomyces cerevisiae." J Biol Chem 282:30562-30569.17726007
  • Benghezal, M., Roubaty, C., Veepuri, V., Knudsen, J., Conzelmann, A. (2007). "SLC1 and SLC4 encode partially redundant acyl-coenzyme A 1-acylglycerol-3-phosphate O-acyltransferases of budding yeast." J Biol Chem 282:30845-30855.17675291
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956