You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSorbitol dehydrogenase 2
Synonyms
  • L-iditol 2-dehydrogenase 2
Gene NameSOR2
Enzyme Class
Biological Properties
General FunctionInvolved in zinc ion binding
Specific FunctionL-iditol + NAD(+) = L-sorbose + NADH
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Fructose and mannose metabolismec00051 Map00051
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00087L-IditolShow
YMDB00110NADShow
YMDB00143NADHShow
YMDB00204L-SorboseShow
GO Classification
Component
Not Available
Function
oxidoreductase activity
zinc ion binding
catalytic activity
binding
ion binding
cation binding
metal ion binding
transition metal ion binding
Process
oxidation reduction
metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDL246C
Gene Sequence>1074 bp ATGTCTCAAAATAGTAACCCTGCAGTAGTTCTAGAGAAAGTCGGCGATATTGCCATCGAG CAAAGACCAATCCCTACCATTAAGGACCCCCATTATGTCAAGTTAGCTATTAAAGCCACT GGTATCTGCGGCTCTGATATTCATTATTATAGAAGCGGTGGTATTGGTAAGTACATATTG AAGGCGCCAATGGTTTTAGGTCATGAATCAAGCGGACAGGTTGTGGAAGTTGGTGATGCC GTCACAAGGGTCAAAGTTGGTGACCGTGTTGCTATTGAACCTGGTGTTCCTAGCCGTTAC TCTGATGAGACCAAAGAAGGGAGCTATAACCTTTGCCCACATATGGCATTTGCTGCAACT CCTCCAATTGATGGTACTCTTGTGAAGTACTATTTATCTCCAGAAGATTTCCTTGTGAAA TTGCCAGAAGGCGTCAGTTATGAAGAGGGCGCTTGTGTCGAACCCTTATCAGTCGGTGTA CACTCTAATAAATTGGCTGGGGTCCGCTTTGGTACCAAAGTTGTTGTATTTGGTGCAGGT CCTGTGGGGCTTTTAACTGGCGCAGTCGCCCGCGCTTTTGGTGCCACCGACGTCATTTTC GTCGATGTATTCGACAACAAGCTACAGAGAGCAAAAGATTTCGGAGCCACAAACACTTTC AATTCTTCCCAGTTTTCCACCGATAAAGCCCAAGACTTGGCCGATGGGGTCCAAAAGCTT TTGGGCGGAAATCACGCAGATGTGGTGTTTGAGTGTTCAGGTGCTGATGTTTGCATTGAT GCCGCTGTCAAAACAACTAAGGTTGGAGGTACCATGGTGCAAGTCGGTATGGGTAAAAAC TACACTAATTTTCCAATTGCTGAAGTTAGTGGAAAGGAAATGAAATTGATTGGATGTTTC CGTTATTCATTCGGTGATTATCGTGACGCTGTGAACTTGGTTGCCACAGGAAAAGTCAAT GTCAAGCCATTGATAACCCACAAATTTAAATTTGAAGATGCAGCCAAGGCTTACGACTAC AACATTGCCCATGGTGGAGAGGTAGTCAAGACTATTATCTTTGGTCCTGAATGA
Protein Properties
Pfam Domain Function
Protein Residues357
Protein Molecular Weight38096.30078
Protein Theoretical pI6.71
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Sorbitol dehydrogenase 2 MSQNSNPAVVLEKVGDIAIEQRPIPTIKDPHYVKLAIKATGICGSDIHYYRSGGIGKYIL KAPMVLGHESSGQVVEVGDAVTRVKVGDRVAIEPGVPSRYSDETKEGSYNLCPHMAFAAT PPIDGTLVKYYLSPEDFLVKLPEGVSYEEGACVEPLSVGVHSNKLAGVRFGTKVVVFGAG PVGLLTGAVARAFGATDVIFVDVFDNKLQRAKDFGATNTFNSSQFSTDKAQDLADGVQKL LGGNHADVVFECSGADVCIDAAVKTTKVGGTMVQVGMGKNYTNFPIAEVSGKEMKLIGCF RYSFGDYRDAVNLVATGKVNVKPLITHKFKFEDAAKAYDYNIAHGGEVVKTIIFGPE
References
External Links
ResourceLink
Saccharomyces Genome Database SOR2
Uniprot IDQ07786
Uniprot NameDHSO2_YEAST
GenBank Gene IDZ74294
Genebank Protein ID1431420
General Reference
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867