You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameNADH kinase POS5, mitochondrial
SynonymsNot Available
Gene NamePOS5
Enzyme Class
Biological Properties
General FunctionInvolved in NAD+ kinase activity
Specific FunctionPhosphorylates both NADH and NAD(+), with a twofold preference for NADH. Anti-oxidant factor and key source of the cellular reductant NADPH
Cellular LocationMitochondrion matrix
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + NADNADP + hydron + ADP
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00110NADShow
YMDB00143NADHShow
YMDB00412NAD(+)Show
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00862hydronShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
NAD+ kinase activity
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPL188W
Gene Sequence>1245 bp ATGTTTGTCAGGGTTAAATTGAATAAACCAGTAAAATGGTATAGGTTCTATAGTACGTTG GATTCACATTCCCTAAAGTTACAGAGCGGCTCGAAGTTTGTAAAAATAGAGGCAGTAAAT AACTTGAGGAGTAGTTCATCAGCAGATTTCGTGTCCCCACCAAATTCCAAATTACAATCT TTAATCTGGCAGAACCCTTTACAAAATGTTTATATAACTAAAAAACCATGGACTCCATCC ACAAGAGAAGCGATGGTTGAATTCATAACTCATTTACATGAGTCATACCCCGAGGTGAAC GTCATTGTTCAACCCGATGTGGCAGAAGAAATTTCCCAGGATTTCAAATCTCCTTTGGAG AATGATCCCAACCGACCTCATATACTTTATACTGGTCCTGAACAAGATATCGTAAACAGA ACAGACTTATTGGTGACATTGGGAGGTGATGGGACTATTTTACACGGCGTATCAATGTTC GGAAATACGCAAGTTCCTCCGGTTTTAGCATTTGCTCTGGGCACTCTGGGCTTTCTATTA CCGTTTGATTTTAAGGAGCATAAAAAGGTCTTTCAGGAAGTAATCAGCTCTAGAGCCAAA TGTTTGCATAGAACACGGCTAGAATGTCATTTGAAAAAAAAGGATAGCAACTCATCTATT GTGACCCATGCTATGAATGACATATTCTTACATAGGGGTAATTCCCCTCATCTCACTAAC CTGGACATTTTCATTGATGGGGAATTTTTGACAAGAACGACAGCAGATGGTGTTGCATTG GCCACTCCAACGGGTTCCACAGCATATTCATTATCAGCAGGTGGATCTATTGTTTCCCCA TTAGTCCCTGCTATTTTAATGACACCAATTTGTCCTCGCTCTTTGTCATTCCGACCACTG ATTTTGCCTCATTCATCCCACATTAGGATAAAGATAGGTTCCAAATTGAACCAAAAACCA GTCAACAGTGTGGTAAAACTTTCTGATGATGGTATTCCTCAACAGGATTTAGATGTTGGT GATGAAAGTTATGTTATAAATGAGGTCGGCACTATATACATAGATGGTACTCAGCTTCCG ACGACAAGAAAAACTGAAAATGACTTTAATAATTCAAAAAAGCCTAAAAGGTCAGGGATT TATTGTGTCGCCAAGACCGAGAATGACTGGATTAGAGGAATCAATGAACTTTGTAGGATT CATTCTAGCTTTAGGCTGACCAAGAGACAGACTGATAATGATTAA
Protein Properties
Pfam Domain Function
Protein Residues414
Protein Molecular Weight46246.5
Protein Theoretical pI9.4
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>NADH kinase POS5, mitochondrial MFVRVKLNKPVKWYRFYSTLDSHSLKLQSGSKFVKIKPVNNLRSSSSADFVSPPNSKLQS LIWQNPLQNVYITKKPWTPSTREAMVEFITHLHESYPEVNVIVQPDVAEEISQDFKSPLE NDPNRPHILYTGPEQDIVNRTDLLVTLGGDGTILHGVSMFGNTQVPPVLAFALGTLGFLS PFDFKEHKKVFQEVISSRAKCLHRTRLECHLKKKDSNSSIVTHAMNDIFLHRGNSPHLTN LDIFIDGEFLTRTTADGVALATPTGSTAYSLSAGGSIVSPLVPAILMTPICPRSLSFRPL ILPHSSHIRIKIGSKLNQKPVNSVVKLSVDGIPQQDLDVGDEIYVINEVGTIYIDGTQLP TTRKTENDFNNSKKPKRSGIYCVAKTENDWIRGINELLGFNSSFRLTKRQTDND
References
External Links
ResourceLink
Saccharomyces Genome Database POS5
Uniprot IDQ06892
Uniprot NamePOS5_YEAST
GenBank Gene IDX84260
Genebank Protein ID668983
General Reference
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Iwahashi, Y., Hitoshio, A., Tajima, N., Nakamura, T. (1989). "Characterization of NADH kinase from Saccharomyces cerevisiae." J Biochem 105:588-593.2547755
  • Outten, C. E., Culotta, V. C. (2003). "A novel NADH kinase is the mitochondrial source of NADPH in Saccharomyces cerevisiae." EMBO J 22:2015-2024.12727869
  • Strand, M. K., Stuart, G. R., Longley, M. J., Graziewicz, M. A., Dominick, O. C., Copeland, W. C. (2003). "POS5 gene of Saccharomyces cerevisiae encodes a mitochondrial NADH kinase required for stability of mitochondrial DNA." Eukaryot Cell 2:809-820.12912900
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106