You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameChitin deacetylase 2
SynonymsNot Available
Gene NameCDA2
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionHydrolyzes the N-acetamido groups of N-acetyl-D- glucosamine residues in chitin
Cellular LocationCytoplasmic
SMPDB Pathways
Amino sugar and nucleotide sugar metabolismPW002413 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Amino sugar and nucleotide sugar metabolismec00520 Map00520
SMPDB ReactionsNot Available
KEGG Reactions
chitin + waterAcetic acid + chitosan + hydron
Metabolites
YMDB IDNameView
YMDB00056Acetic acidShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
catalytic activity
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
Gene Properties
Chromosome Locationchromosome 12
LocusYLR308W
Gene Sequence>939 bp ATGAGAATACAACTAAATACAATTGATTTGCAATGTATTATTGCACTTTCCTGTCTGGGG CAATTTGTTCACGCGGAAGCTAATAGGGAAGATTTAAAGCAGATAGACTTTCAATTTCCT GTATTGGAAAGGGCAGCTACAAAAACGCCTTTTCCGGATTGGCTTAGTGCATTTACCGGG TTAAAAGAATGGCCTGGGTTAGATCCACCTTATATACCTTTAGATTTCATTGATTTCAGT CAAATTCCAGATTATAAGGAATATGATCAAAACCATTGCGACAGTGTTCCAAGGGACTCG TGCTCTTTCGATTGCCATCACTGCACCGAACACGATGATGTGTACACATGTTCCAAACTT TCCCAGACATTTGACGATGGTCCTTCTGCTTCCACTACTAAATTATTGGACCGGTTGAAG CATAATTCCACCTTCTTCAATTTAGGTGTCAATATAGTTCAACATCCAGATATCTATCAA AGAATGCAAAAGGAGGGACACTTAATCGGCTCACATACCTGGTCTCACGTATATTTGCCA AATGTATCGAATGAAAAAATTATAGCTCAAATTGAATGGTCCATCTGGGCGATGAATGCT ACTGGCAACCATACCCCCAAATGGTTCAGACCTCCATATGGCGGAATAGATAATAGAGTA AGAGCAATAACAAGGCAATTTGGCTTACAAGCCGTCTTATGGGATCACGATACTTTTGAT TGGAGCCTCCTTCTCAATGATTCTGTCATAACTGAACAAGAAATTCTTCAAAATGTAATA AACTGGAACAAGTCAGGAACCGGATTAATATTAGAACACGATTCAACGGAAAAAACTGTC GATCTTGCCATTAAAATAAATAAGTTGATAGGTGATGATCAATCAACAGTTTCTCATTGT GTCGGCGGAATTGATTACATAAAAGAATTCTTGTCCTAA
Protein Properties
Pfam Domain Function
Protein Residues312
Protein Molecular Weight35692.80078
Protein Theoretical pI5.03
Signalling Regions
  • 1-25
Transmembrane Regions
  • None
Protein Sequence>Chitin deacetylase 2 MRIQLNTIDLQCIIALSCLGQFVHAEANREDLKQIDFQFPVLERAATKTPFPDWLSAFTG LKEWPGLDPPYIPLDFIDFSQIPDYKEYDQNHCDSVPRDSCSFDCHHCTEHDDVYTCSKL SQTFDDGPSASTTKLLDRLKHNSTFFNLGVNIVQHPDIYQRMQKEGHLIGSHTWSHVYLP NVSNEKIIAQIEWSIWAMNATGNHTPKWFRPPYGGIDNRVRAITRQFGLQAVLWDHDTFD WSLLLNDSVITEQEILQNVINWNKSGTGLILEHDSTEKTVDLAIKINKLIGDDQSTVSHC VGGIDYIKEFLS
References
External Links
ResourceLink
Saccharomyces Genome Database CDA2
Uniprot IDQ06703
Uniprot NameCDA2_YEAST
GenBank Gene IDAY557951
Genebank Protein ID45269794
General Reference
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Mishra, C., Semino, C. E., McCreath, K. J., de la Vega, H., Jones, B. J., Specht, C. A., Robbins, P. W. (1997). "Cloning and expression of two chitin deacetylase genes of Saccharomyces cerevisiae." Yeast 13:327-336.9133736