You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameN-terminal acetyltransferase B complex catalytic subunit NAT3
Synonyms
  • NatB complex subunit NAT3
  • NatB Nalpha terminal acetyltransferase 3
Gene NameNAT3
Enzyme Class
Biological Properties
General FunctionInvolved in N-acetyltransferase activity
Specific FunctionCatalytic subunit of the NatB N-terminal acetyltransferase, which catalyzes acetylation of the amino- terminal methionine residues of all proteins beginning with Met- Asp or Met-Glu and of some proteins beginning with Met-Asn or Met- Met. NatB acetylates TPM1 protein and regulates tropomyocin-actin interactions
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00312Acetyl-CoAShow
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
acyltransferase activity
acetyltransferase activity
N-acetyltransferase activity
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPR131C
Gene Sequence>YPR131C Chr 16 ATGACAACAATTCAGCCTTTTGAACCTGTCGATTTATTCAAAACTAACAATGTCAACCTT GATATCTTAACAGAAAACTTCCCTTTAGAGTTTTATTTTGAATACATGATAATATGGCCA GACCTTTTTTTCAAAAGTTCAGAAATGACTGTTGATCCTACATTTAAGCATAATATCTCT GGTTACATGATGGCAAAAACAGAAGGCAAGACCACGGAGTGGCACACTCATATAACTGCA GTGACAGTAGCTCCAAGATTCCGCCGAATATCGCTAGCTTCGAAGTTATGTAATACTTTG GAGACCATGACCGATGTCATGCCCCATGAAGTCAACTTTATCGATCTTTTCGTCAAGTGC AATAACCAATTGGCCATCAAACTTTACGAAAAATTGGGATACAGTGTCTACAGGAGAGTG GTGGGATATTATAACTCAGCTGAAGATGGGTATCCAGATACCCTGAAAAAAGTAGATGAC AATAAAGATGCTTTTGATATGAGAAAAGCTATGGCTAGGGACAGGAACAGAAGCGTACGG CCGGATGGAAGAAGCCATAAATGCTATCCACATGATGTAAGATTTTAA
Protein Properties
Pfam Domain Function
Protein Residues195
Protein Molecular Weight22921.0
Protein Theoretical pI7.59
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>N-terminal acetyltransferase B complex catalytic subunit NAT3 MTTIQPFEPVDLFKTNNVNLDILTENFPLEFYFEYMIIWPDLFFKSSEMTVDPTFKHNIS GYMMAKTEGKTTEWHTHITAVTVAPRFRRISLASKLCNTLETMTDVMPHEVNFIDLFVKC NNQLAIKLYEKLGYSVYRRVVGYYNSAEDGYPDTLKKVDDNKDAFDMRKAMARDRNRSVR PDGRSHKCYPHDVRF
References
External Links
ResourceLink
Saccharomyces Genome Database NAT3
Uniprot IDQ06504
Uniprot NameNAT3_YEAST
General Reference
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Polevoda, B., Norbeck, J., Takakura, H., Blomberg, A., Sherman, F. (1999). "Identification and specificities of N-terminal acetyltransferases from Saccharomyces cerevisiae." EMBO J 18:6155-6168.10545125
  • Polevoda, B., Cardillo, T. S., Doyle, T. C., Bedi, G. S., Sherman, F. (2003). "Nat3p and Mdm20p are required for function of yeast NatB Nalpha-terminal acetyltransferase and of actin and tropomyosin." J Biol Chem 278:30686-30697.12783868
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Singer, J. M., Shaw, J. M. (2003). "Mdm20 protein functions with Nat3 protein to acetylate Tpm1 protein and regulate tropomyosin-actin interactions in budding yeast." Proc Natl Acad Sci U S A 100:7644-7649.12808144