Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSterol 3-beta-glucosyltransferase
Synonyms
  • Autophagy-related protein 26
  • UDP-glycosyltransferase 51
Gene NameATG26
Enzyme Class
Biological Properties
General FunctionInvolved in transferase activity, transferring hexosyl groups
Specific FunctionMay be involved in decane metabolism and autophagy. Involved in the biosynthesis of sterol glucoside
Cellular LocationCytoplasm. Membrane; Peripheral membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Uridine diphosphate glucose + ergosterolUridine 5'-diphosphate + ergosteryl 3-beta-D-glucoside + hydron
Metabolites
YMDB IDNameView
YMDB00212Uridine diphosphate glucoseShow
YMDB00307Uridine 5'-diphosphateShow
YMDB00415UDP-D-glucoseShow
YMDB00543ergosterolShow
YMDB00777ergosteryl 3-beta-D-glucosideShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity
transferase activity, transferring glycosyl groups
transferase activity, transferring hexosyl groups
Process
cellular lipid metabolic process
lipid modification
lipid glycosylation
metabolic process
primary metabolic process
carbohydrate metabolic process
lipid metabolic process
Gene Properties
Chromosome Locationchromosome 12
LocusYLR189C
Gene Sequence>3597 bp ATGCCCATCACTCAAATCATATCAGCGTCTGATAGCGAGGCGGGGCCAAAACCAAGCATT TCGTTGGTACCTGATAAGCCATCTGAGCCAGAAACTTCCCCTAGGCATCATCGCCTTTCA AGGTCACTTTCGAAGTTCAAGCGCTGGAGAGGAAGATCAAATAGCAGTTTATCGATGGGG TCGTCTGAGCAGCAAGAACTGCAGGACAGTCCAAATGAAGCCCGTAGTGATGATGACGAA AACGGTTACAATAACGATAATGCAGATGACTTGGCGAAATCCAAGTATATGATGAAAAGT ATTGCCGGTTTATTAACTACTGCTAGTGTGTATGCAGGGATGAATAATGCTCAAGAAATG AATGTGTTGTCGCAAGTTGATTCTGAAGAATCTGATTCCAGTGATAGTTTCCAGGAAAAC ATTGGTCGAAATGAGGTAAAAAGCAAAAAGGAAAATCTCAAAACTAAATCGCATCCGGAA GTACCAAGATTAGACAAAAGAAAGCCAACTTTATTCGACTTCTCAATAACTAGGGAAAAA CTGTCAAAAGACAATGTGGCTAAGTTGAGACAGCGGTTTTGTTTAGACGAACAGGAACCA TTTTTGAATGATTTCCCTGCATGGCTACTTAAAGATGTGTTGGTTCAAGGCCATATTTTT ATTACAACAAAACATTTCCTATTCTTTGCATATTTACCTAAGAATCCTCGGTCGGTTAAA ATGTCTGGAAACCTTAATATCAGGACAAAACTAATTAGGTCTACCAGGTATTGGTGCGTA CTAAAGAATCATTTATTTTCTATGTATACCTCATCAACTGAGCTATACTTTCCGGTTTTA ACCATAGATTTGAGGGAGGTCCAAAAAATTGAAACACAAAAACATACCTTAAACGGGAGT GCTACGAAAACATTTAAGCTTTACACAGATGAAAGTACATTCAAATTCAATGCAGATTCA GAGTTCTCCGCTAAATCGTGGGTGAACGCTTTGAAAAAGGAGCAGTTCGCAGCTCAGAAT TCTGAAAACAATTCGATAAGTTTAAAAATTCCGCTGCCCAACATTATAGAGATAGATGAT CAACCTATAGTCAACAAAGCTTTAACATTGAGATTAAGAGCTTTGGAGAGCTCACAGACC TATGCTATCGATGATTTCATGTTTGTTTTCATGGATGGGTCCGGTAGTCAGGTCAAAGAG AGCCTTGGCGAACAGTTGGCTATATTGCAGAAATCCGGTGTTAATACACTTTATTATGAT ATTCCAGCCAAGAAATCAAAATCAAGTTTTGGAAAAGAGACACCAGCTACAGTTGAGCAA AAGAATAACGGCGAGGATTCAAAATATTTGAATGTTCCAACTTCGGCTGTGCCTTCTTCG GAAAATGGGAAAAAGAGTCGATTCAGATTTAGAGAAAGAAGCAATAGTTGGTTTCGTAGA GCTAAACCTCTTGAAGATTCTCAAGTTGAGGATGTGGAGGAAATATATAAAGATGCGGCG AATGATATAGACTCTTCTGTGCATTCCACGATTCATATTCATGAACAAGAAGATAGTCAA GAGCAAACCGTAGCTTGGAAGCCAAGTCACCTCAAAAATTTTGCCGAAATGTGGGCTGCC AAACCAATACACTACCGGAACAAGTTTATCCCGTTTCAAAAGGATGATACCTATTTGATT AAAGAAACAGAAGAGGTTTCTGCTAACGAGCGGTTCAGGTACCATTTCAAGTTTAATAAA GAGAAGTCACTAATCAGTACTTACTACACATACCTGAATAGAAATGTTCCCGTTTATGGT AAGATTTACGTATCCAATGATACGGTGTGCTTCAGATCGTTATTACCAGGGTCTAATACA TACATGGTTTTGCCATTGGTTGATGTGGAGACATGCTATAAAGAAAAGGGATTTCGATTT GGTTATTTTGTATTGGTTATAGTAATTCACGGTCACGAGGAGCTATTTTTTGAATTTAGC ACTGAGGTCGCCAGGGATGATATTGAACGCATTCTTTTAAAGCTCTTAGATAACATATAT GCAAGCAGTGCAGAAGGATCGAATATATCGAGTGCTTCTCTTGGCGATGTTCAGCATAAC CCTGACTCAGCGAAGTTGAAGCTTTTCGAAGATAAAATTAATGCCGAGGGCTTTGAGGTA CCGTTAATGATTGATGAGAATCCGCACTATAAAACAAGCATAAAACCAAACAAGAGTTAT AAGTTTGGATTATTGACGATTGGCTCAAGAGGGGATGTTCAACCATATATTGCACTTGGA AAGGGCTTGATAAAAGAAGGTCACCAAGTGGTAATAATTACACATTCGGAATTTAGAGAC TTTGTTGAAAGTCATGGAATCCAGTTTGAAGAGATTGCTGGTAACCCAGTGGAGTTGATG TCCTTGATGGTGGAAAATGAATCAATGAATGTTAAAATGCTGAGAGAAGCTTCGAGCAAA TTTAGGGGATGGATCGATGCTCTTTTACAGACATCTTGGGAGGTTTGTAACAGAAGAAAA TTTGATATTCTGATTGAATCACCCTCAGCTATGGTTGGTATTCATATTACTGAAGCATTG CAAATTCCTTATTTTCGAGCATTTACCATGCCATGGACAAGAACAAGAGCATATCCACAT GCATTTATTGTACCAGATCAAAAAAGGGGCGGTAACTATAACTACCTGACACATGTCCTT TTCGAAAACGTTTTCTGGAAGGGAATTAGTGGGCAAGTAAACAAGTGGAGAGTTGAAACT CTAGGTTTAGGGAAAACAAATCTTTTTCTTTTACAGCAGAATAATGTTCCTTTCTTATAC AATGTTTCTCCTACAATTTTTCCGCCATCAATTGATTTTAGCGAGTGGGTGAGAGTTACA GGATATTGGTTTCTTGATGATAAGAGTACTTTCAAACCGCCAGCAGAATTACAAGAATTT ATTTCTGAGGCAAGATCAAAAGGAAAAAAATTGGTTTATATCGGGTTTGGTTCGATTGTA GTCTCTAATGCCAAAGAAATGACGGAAGCTCTTGTCGAAGCAGTTATGGAAGCAGATGTA TACTGCATTTTAAATAAGGGATGGTCAGAAAGGTTGGGCGATAAGGCGGCAAAGAAGACA GAGGTAGATCTTCCAAGAAACATTTTAAATATCGGAAACGTTCCCCATGATTGGTTGTTC CCACAAGTCGATGCTGCCGTTCACCATGGTGGTTCTGGAACTACTGGAGCTTCATTACGT GCTGGTTTACCTACTGTTATAAAACCTTTCTTTGGTGATCAGTTCTTTTATGCAGGTAGA GTAGAAGACATTGGAGTTGGTATTGCTTTAAAGAAACTTAACGCTCAAACATTAGCAGAT GCTTTAAAAGTAGCTACGACGAACAAAATAATGAAGGATAGAGCTGGATTAATAAAGAAG AAAATTTCCAAAGAAGATGGGATTAAAACTGCAATAAGTGCAATTTACAACGAACTTGAG TATGCAAGAAGCGTTACTTTATCAAGAGTGAAAACTCCGCGCAAGAAAGAGGAAAATGTA GATGCAACCAAACTGACACCTGCTGAAACAACGGATGAAGGGTGGACGATGATTTAA
Protein Properties
Pfam Domain Function
Protein Residues1198
Protein Molecular Weight136053.0
Protein Theoretical pI7.6
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Sterol 3-beta-glucosyltransferase MPITQIISASDSEAGPKPSISLVPDKPSEPETSPRHHRLSRSLSKFKRWRGRSNSSLSMG SSEQQELQDSPNEARSDDDENGYNNDNADDLAKSKYMMKSIAGLLTTASVYAGMNNAQEM NVLSQVDSEESDSSDSFQENIGRNEVKSKKENLKTKSHPEVPRLDKRKPTLFDFSITREK LSKDNVAKLRQRFCLDEQEPFLNDFPAWLLKDVLVQGHIFITTKHFLFFAYLPKNPRSVK MSGNLNIRTKLIRSTRYWCVLKNHLFSMYTSSTELYFPVLTIDLREVQKIETQKHTLNGS ATKTFKLYTDESTFKFNADSEFSAKSWVNALKKEQFAAQNSENNSISLKIPLPNIIEIDD QPIVNKALTLRLRALESSQTYAIDDFMFVFMDGSGSQVKESLGEQLAILQKSGVNTLYYD IPAKKSKSSFGKETPATVEQKNNGEDSKYLNVPTSAVPSSENGKKSRFRFRERSNSWFRR AKPLEDSQVEDVEEIYKDAANDIDSSVHSTIHIHEQEDSQEQTVAWKPSHLKNFAEMWAA KPIHYRNKFIPFQKDDTYLIKETEEVSANERFRYHFKFNKEKSLISTYYTYLNRNVPVYG KIYVSNDTVCFRSLLPGSNTYMVLPLVDVETCYKEKGFRFGYFVLVIVIHGHEELFFEFS TEVARDDIERILLKLLDNIYASSAEGSNISSASLGDVQHNPDSAKLKLFEDKINAEGFEV PLMIDENPHYKTSIKPNKSYKFGLLTIGSRGDVQPYIALGKGLIKEGHQVVIITHSEFRD FVESHGIQFEEIAGNPVELMSLMVENESMNVKMLREASSKFRGWIDALLQTSWEVCNRRK FDILIESPSAMVGIHITEALQIPYFRAFTMPWTRTRAYPHAFIVPDQKRGGNYNYLTHVL FENVFWKGISGQVNKWRVETLGLGKTNLFLLQQNNVPFLYNVSPTIFPPSIDFSEWVRVT GYWFLDDKSTFKPPAELQEFISEARSKGKKLVYIGFGSIVVSNAKEMTEALVEAVMEADV YCILNKGWSERLGDKAAKKTEVDLPRNILNIGNVPHDWLFPQVDAAVHHGGSGTTGASLR AGLPTVIKPFFGDQFFYAGRVEDIGVGIALKKLNAQTLADALKVATTNKIMKDRAGLIKK KISKEDGIKTAISAIYNELEYARSVTLSRVKTPRKKEENVDATKLTPAETTDEGWTMI
References
External Links
ResourceLink
Saccharomyces Genome Database ATG26
Uniprot IDQ06321
Uniprot NameATG26_YEAST
GenBank Gene IDU17246
Genebank Protein ID577215
General Reference
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Warnecke, D., Erdmann, R., Fahl, A., Hube, B., Muller, F., Zank, T., Zahringer, U., Heinz, E. (1999). "Cloning and functional expression of UGT genes encoding sterol glucosyltransferases from Saccharomyces cerevisiae, Candida albicans, Pichia pastoris, and Dictyostelium discoideum." J Biol Chem 274:13048-13059.10224056
  • Klionsky, D. J., Cregg, J. M., Dunn, W. A. Jr, Emr, S. D., Sakai, Y., Sandoval, I. V., Sibirny, A., Subramani, S., Thumm, M., Veenhuis, M., Ohsumi, Y. (2003). "A unified nomenclature for yeast autophagy-related genes." Dev Cell 5:539-545.14536056
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956