You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameUncharacterized oxidoreductase YMR226C
SynonymsNot Available
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionNot Available
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
NADP + L-AllothreonineL-2-amino-3-oxobutanoic acid + NADPH + hydron
NADP + L-SerineNADPH + hydron + L-3-Oxoalanine
Metabolites
YMDB IDNameView
YMDB00112L-SerineShow
YMDB00295L-AllothreonineShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00695L-2-amino-3-oxobutanoic acidShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
oxidoreductase activity
catalytic activity
binding
Process
oxidation reduction
metabolic process
Gene Properties
Chromosome LocationNot Available
LocusYMR226C
Gene Sequence>804 bp ATGTCCCAAGGTAGAAAAGCTGCAGAAAGATTGGCTAAGAAGACTGTCCTCATTACAGGT GCATCTGCTGGTATTGGTAAGGCGACCGCATTAGAGTACTTGGAGGCATCCAATGGTGAT ATGAAACTGATCTTGGCTGCTAGAAGATTAGAAAAGCTCGAGGAATTGAAGAAGACCATT GATCAAGAGTTTCCAAACGCAAAAGTTCATGTGGCCCAGCTGGATATCACTCAAGCAGAA AAAATCAAGCCCTTCATTGAAAACTTGCCACAAGAGTTCAAGGATATTGACATTCTGGTG AACAATGCCGGAAAGGCTCTTGGCAGTGACCGTGTGGGCCAGATCGCAACGGAGGATATC CAGGACGTGTTTGACACCAACGTCACGGCTTTAATCAATATCACACAAGCTGTACTGCCC ATATTCCAAGCCAAGAATTCAGGAGATATTGTAAATTTGGGTTCAATCGCTGGCAGAGAC GCATACCCAACAGGTTCTATCTATTGTGCCTCTAAGTTTGCCGTGGGGGCGTTCACTGAT AGTTTGAGAAAGGAGCTCATCAACACTAAAATTAGAGTCATTCTAATTGCACCAGGGCTA GTCGAGACTGAATTTTCACTAGTTAGATACAGAGGTAACGAGGAACAAGCCAAGAATGTT TACAAGGATACTACCCCATTGATGGCTGATGACGTGGCTGATCTGATCGTCTATGCAACT TCCAGAAAACAAAATACTGTAATTGCAGACACTTTAATCTTTCCAACAAACCAAGCGTCA CCTCATCATATCTTCCGTGGATAA
Protein Properties
Pfam Domain Function
Protein Residues267
Protein Molecular Weight29158.09961
Protein Theoretical pI6.81
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Uncharacterized oxidoreductase YMR226C MSQGRKAAERLAKKTVLITGASAGIGKATALEYLEASNGDMKLILAARRLEKLEELKKTI DQEFPNAKVHVAQLDITQAEKIKPFIENLPQEFKDIDILVNNAGKALGSDRVGQIATEDI QDVFDTNVTALINITQAVLPIFQAKNSGDIVNLGSIAGRDAYPTGSIYCASKFAVGAFTD SLRKELINTKIRVILIAPGLVETEFSLVRYRGNEEQAKNVYKDTTPLMADDVADLIVYAT SRKQNTVIADTLIFPTNQASPHHIFRG
References
External Links
ResourceLink
Saccharomyces Genome Database YMR226C
Uniprot IDQ05016
Uniprot NameYM71_YEAST
GenBank Gene IDZ49939
Genebank Protein ID887607
General Reference
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Fujisawa, H., Nagata, S., Misono, H. (2003). "Characterization of short-chain dehydrogenase/reductase homologues of Escherichia coli (YdfG) and Saccharomyces cerevisiae (YMR226C)." Biochim Biophys Acta 1645:89-94.12535615