You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameD-arabinose 1-dehydrogenase
Synonyms
  • NAD(+)-specific D-arabinose dehydrogenase
Gene NameARA2
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionD-arabinose + NAD(+) = D-arabinono-1,4-lactone + NADH
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
NAD + D-ArabinoseD-arabinono-1,4-lactone + NADH + hydron
Metabolites
YMDB IDNameView
YMDB00014D-arabinono-1,4-lactoneShow
YMDB00110NADShow
YMDB00143NADHShow
YMDB00412NAD(+)Show
YMDB00654D-ArabinoseShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
catalytic activity
oxidoreductase activity
Process
metabolic process
oxidation reduction
Gene Properties
Chromosome Locationchromosome 13
LocusYMR041C
Gene Sequence>1008 bp ATGGTTAATGAAAAAGTGAATCCATTCGACTTAGCTTCGGTTTCTCCTTTAGTCTTAGGA GGTGCAATACTGAACCAGCAATATACAGATGAGCCAGAATCCATTCCACTGGAAGACATA ATCAAATACGCATTTTCGCATGGTATCAATGCAATTGACACTTCTCCCTACTATGGCCCT AGTGAGGTTCTTTATGGTAGGGCACTGTCCAATTTAAGGAATGAATTTCCCAGAGACACT TATTTTATATGCACAAAGGTTGGGCGTATTGGTGCGGAAGAGTTTAACTATTCTAGAGAT TTCGTGAGATTTAGTGTTCACAGATCGTGCGAAAGATTACACACTACATATCTCGATTTG GTGTACTTGCACGATGTCGAGTTTGTCAAATTTCCAGACATCTTAGAGGCATTAAAGGAA TTGAGGACCTTGAAGAACAAAGGAGTTATCAAAAATTTTGGCATATCAGGCTACCCAATC GACTTTATCACCTGGCTTGCTGAGTACTGCTCTACCGAGGAAAGTGATATTGGGTCATTG GATGCAGTATTGTCCTATTGTAACTTGAACTTACAAAACAATAAGCTATTGAACTTTCGA GAAAGACTGCTACGCAATGCTAAACTGAAAATGGTTTGCAACGCATCAATCTTGAGCATG TCGCTACTAAGGTCACAGGAGACAAGACAGTTTCACCCGTGTTCTCATGAATTGAGAGAA TGCGCATCTCAGGCTGCCAAATACTGTCAAGAACAAAATGTCGACTTAGCCGATTTGGCC ACAAGATACGCGATTTCGGAATGGGTAGGAAAGGGACCCGTTGTTCTTGGAGTCAGTAGC ATGGAAGAATTGAAACTTGCTCTGGATAATTACGAAATTGTGAAATCGAATGGCAACAGA TTATCTTCTAAGGACGGACAACTAGTAGAATATATCCAAAAGAATATTTTTAAAGAACAT TTTAATGAAGAGTGGTCTTCAGGTATTCCTCATCCAGAAATGATATAA
Protein Properties
Pfam Domain Function
Protein Residues335
Protein Molecular Weight38220.0
Protein Theoretical pI5.28
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>D-arabinose 1-dehydrogenase MVNEKVNPFDLASVSPLVLGGAILNQQYTDEPESIPLEDIIKYAFSHGINAIDTSPYYGP SEVLYGRALSNLRNEFPRDTYFICTKVGRIGAEEFNYSRDFVRFSVHRSCERLHTTYLDL VYLHDVEFVKFPDILEALKELRTLKNKGVIKNFGISGYPIDFITWLAEYCSTEESDIGSL DAVLSYCNLNLQNNKLLNFRERLLRNAKLKMVCNASILSMSLLRSQETRQFHPCSHELRE CASQAAKYCQEQNVDLADLATRYAISEWVGKGPVVLGVSSMEELKLALDNYEIVKSNGNR LSSKDGQLVEYIQKNIFKEHFNEEWSSGIPHPEMI
References
External Links
ResourceLink
Saccharomyces Genome Database ARA2
Uniprot IDQ04212
Uniprot NameARA2_YEAST
GenBank Gene IDAB237161
Genebank Protein ID90991337
General Reference
  • Amako, K., Fujita, K., Shimohata, T. A., Hasegawa, E., Kishimoto, R., Goda, K. (2006). "NAD+-specific D-arabinose dehydrogenase and its contribution to erythroascorbic acid production in Saccharomyces cerevisiae." FEBS Lett 580:6428-6434.17097644
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872