You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameDephospho-CoA kinase CAB5
Synonyms
  • DPCK
  • Dephosphocoenzyme A kinase
Gene NameCAB5
Enzyme Class
Biological Properties
General FunctionInvolved in dephospho-CoA kinase activity
Specific FunctionCatalyzes the phosphorylation of the 3'-hydroxyl group of dephosphocoenzyme A to form coenzyme A
Cellular LocationEndoplasmic reticulum. Mitochondrion. Nucleus.
SMPDB Pathways
Pantothenate and CoA biosynthesisPW002463 ThumbThumb?image type=greyscaleThumb?image type=simple
beta-Alanine metabolismPW002381 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pantothenate and CoA biosynthesisec00770 Map00770
beta-Alanine metabolismec00410 Map00410
SMPDB Reactions
Dephospho-CoA + Adenosine triphosphatehydron + ADP + Coenzyme A
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00109Adenosine triphosphateShow
YMDB00357Dephospho-CoAShow
YMDB00862hydronShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
kinase activity
catalytic activity
dephospho-CoA kinase activity
transferase activity
transferase activity, transferring phosphorus-containing groups
Process
cellular metabolic process
cofactor metabolic process
coenzyme metabolic process
coenzyme biosynthetic process
coenzyme A biosynthetic process
metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR196C
Gene Sequence>726 bp ATGCTGGTAGTGGGATTGACAGGTGGGATCGCTTGTGGTAAGAGCACAGTGTCGAGAAGA CTCAGAGACAAATACAAACTACCCATTGTTGATGCGGACAAGATTGCTAGACAAGTGGTC GAACCAGGACAGAATGCTTATGATCAAATTGTGTTATACTTCAAGGACAAAATACCGAAT TTATTATTGGAGGATGGGCATTTAAATCGTGAAGCCCTAGGGAAATGGGTTTTTAGTCAT AAAGAAGATTTGCAAGCCTTGAATGGGATAACACATCCTGCAATCAGGTATGCAATGTTC AAAGAAATTGGCTACTATTACTTGAAGGGATATAGAATGTGTGTATTGGATGTGCCACTC TTATTTGAAGGAAATCTGGATTCAATATGCGGAGTGACTGTAAGCGTAATTTGTACGCAA GAATTGCAACTAGAAAGATTAATGACAAGAAATCCTGAACTTAGTGAAGAAGATGCAAAA AACAGGCTAAATAGTCAAATGAGCACTGAAGAAAGGATGGCAAGATCTGACTATATCCTA CAAAATAACAGCACATTGGTTGACTTATACGAACAGATTGAAAGTGTTGTAAAAAAAATC CAACCTAGTAAATTAAGAACTGTTTTGGAGTATTTCCCACCTTTTGGGGCCGTAAGTGCC AGTAGCATCGTCATGTCCAGATTACTGATGAAAAAACTTCAAAATAAAAAGTCTTCAGCG GTATAA
Protein Properties
Pfam Domain Function
Protein Residues241
Protein Molecular Weight27339.5
Protein Theoretical pI8.81
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Dephospho-CoA kinase CAB5 MLVVGLTGGIACGKSTVSRRLRDKYKLPIVDADKIARQVVEPGQNAYDQIVLYFKDKIPN LLLEDGHLNREALGKWVFSHKEDLQALNGITHPAIRYAMFKEIGYYYLKGYRMCVLDVPL LFEGNLDSICGVTVSVICTQELQLERLMTRNPELSEEDAKNRLNSQMSTEERMARSDYIL QNNSTLVDLYEQIESVVKKIQPSKLRTVLEYFPPFGAVSASSIVMSRLLMKKLQNKKSSA V
References
External Links
ResourceLink
Saccharomyces Genome Database CAB5
Uniprot IDQ03941
Uniprot NameCAB5_YEAST
GenBank Gene IDAY557679
Genebank Protein ID45269251
General Reference
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Hazbun, T. R., Malmstrom, L., Anderson, S., Graczyk, B. J., Fox, B., Riffle, M., Sundin, B. A., Aranda, J. D., McDonald, W. H., Chiu, C. H., Snydsman, B. E., Bradley, P., Muller, E. G., Fields, S., Baker, D., Yates, J. R. 3rd, Davis, T. N. (2003). "Assigning function to yeast proteins by integration of technologies." Mol Cell 12:1353-1365.14690591
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Reinders, J., Zahedi, R. P., Pfanner, N., Meisinger, C., Sickmann, A. (2006). "Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics." J Proteome Res 5:1543-1554.16823961
  • Olzhausen, J., Schubbe, S., Schuller, H. J. (2009). "Genetic analysis of coenzyme A biosynthesis in the yeast Saccharomyces cerevisiae: identification of a conditional mutation in the pantothenate kinase gene CAB1." Curr Genet 55:163-173.19266201