You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameN-alpha-acetyltransferase 30, NatC catalytic subunit
Synonyms
  • L-A virus GAG protein N-acetyltransferase subunit MAK3
  • Maintenance of killer protein 3
  • N-terminal acetyltransferase C complex catalytic subunit MAK3
  • NatC complex subunit MAK3
Gene NameMAK3
Enzyme Class
Biological Properties
General FunctionInvolved in N-acetyltransferase activity
Specific FunctionCatalytic component of the NatC N-terminal acetyltransferase, which catalyzes acetylation of the N-terminus Met of L-A virus Gag protein
Cellular LocationCytoplasm. Nucleus
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00312Acetyl-CoAShow
GO Classification
Component
Not Available
Function
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
acyltransferase activity
acetyltransferase activity
N-acetyltransferase activity
catalytic activity
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPR051W
Gene Sequence>531 bp ATGGAAATAGTGTACAAGCCATTGGACATACGTAACGAAGAGCAGTTTGCTAGTATTAAA AAACTAATAGATGCGGATCTATCAGAGCCGTACTCGATATACGTATATAGGTATTTCTTG AACCAATGGCCCGAGTTAACGTACATTGCCGTTGACAACAAGAGTGGAACGCCTAACATA CCCATTGGTTGCATAGTGTGTAAGATGGACCCGCATAGAAACGTGAGACTGAGAGGATAT ATAGGAATGCTAGCCGTAGAGTCCACATACCGCGGGCATGGCATAGCAAAGAAACTAGTG GAAATTGCCATAGATAAAATGCAAAGGGAACATTGCGATGAGATCATGTTAGAAACAGAG GTGGAAAATTCGGCGGCTCTAAACTTATATGAAGGAATGGGTTTCATCAGAATGAAACGG ATGTTCCGCTACTACTTGAATGAAGGGGACGCCTTTAAACTGATATTGCCGTTGACTGAA AAGAGCTGCACTCGGTCTACGTTCCTAATGCATGGCCGGCTGGCCACATAA
Protein Properties
Pfam Domain Function
Protein Residues176
Protein Molecular Weight20456.59961
Protein Theoretical pI7.44
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>N-alpha-acetyltransferase 30, NatC catalytic subunit MEIVYKPLDIRNEEQFASIKKLIDADLSEPYSIYVYRYFLNQWPELTYIAVDNKSGTPNI PIGCIVCKMDPHRNVRLRGYIGMLAVESTYRGHGIAKKLVEIAIDKMQREHCDEIMLETE VENSAALNLYEGMGFIRMKRMFRYYLNEGDAFKLILPLTEKSCTRSTFLMHGRLAT
References
External Links
ResourceLink
Saccharomyces Genome Database MAK3
Uniprot IDQ03503
Uniprot NameNAA30_YEAST
GenBank Gene IDM95912
Genebank Protein ID171882
General Reference
  • Tercero, J. C., Wickner, R. B. (1992). "MAK3 encodes an N-acetyltransferase whose modification of the L-A gag NH2 terminus is necessary for virus particle assembly." J Biol Chem 267:20277-20281.1400344
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Tercero, J. C., Riles, L. E., Wickner, R. B. (1992). "Localized mutagenesis and evidence for post-transcriptional regulation of MAK3. A putative N-acetyltransferase required for double-stranded RNA virus propagation in Saccharomyces cerevisiae." J Biol Chem 267:20270-20276.1339437
  • Polevoda, B., Sherman, F. (2001). "NatC Nalpha-terminal acetyltransferase of yeast contains three subunits, Mak3p, Mak10p, and Mak31p." J Biol Chem 276:20154-20159.11274203
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106