You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMedium-chain fatty acid ethyl ester synthase/esterase 1
Synonyms
  • Alcohol O-acetyltransferase
  • Ethyl ester biosynthesis protein 1
Gene NameEEB1
Enzyme Class
Biological Properties
General FunctionInvolved in carboxylesterase activity
Specific FunctionDisplays enzymatic activity both for medium-chain fatty acid (MCFA) ethyl ester synthesis and hydrolysis (esterase activity). MCFA are toxic for yeast and this enzyme could thus be involved in their detoxification by esterification
Cellular LocationCytoplasmic
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00312Acetyl-CoAShow
YMDB00570isoamylolShow
YMDB00571isoamyl acetateShow
YMDB00790Isopentyl acetateShow
YMDB00798IsopentanolShow
GO Classification
Component
Not Available
Function
carboxylesterase activity
catalytic activity
hydrolase activity
hydrolase activity, acting on ester bonds
Process
Not Available
Gene Properties
Chromosome Locationchromosome 16
LocusYPL095C
Gene Sequence>1371 bp ATGTTTCGCTCGGGTTACTATCCAACTGTCACTCCTAGCCATTGGGGCTATAACGGCACC GTCAAACATGTACTGGGAGAGAAAGGAACCAAGTCTTTGGCTTTCAGAGATTCTAAGCGC CAAATTCCTCTTCATGAATTCGTAACCAAACACGTGCCTACACTCAAAGATGGTGCAAAT TTTAGGTTAAACAGCTTGCTTTTCACAGGTTACTTACAGACCCTTTATTTGTCAGCCGGT GATTTTTCCAAAAAATTTCAGGTATTTTATGGAAGAGAGATTATAAAATTTTCTGATGGA GGGGTCTGCACTGCAGATTGGGTTATGCCTGAATGGGAGCAAACATATTCATTAAATGCT GAAAAGGCTAGTTTTAACGAGAAACAATTTTCGAACGATGAAAAGGCCACCCATCCAAAG GGTTGGCCTCGTCTTCACCCGAGAACTAGATATCTATCCTCTGAGGAACTTGAAAAATGT CATTCTAAGGGTTATTCTTACCCTTTAGTGGTAGTACTTCATGGTCTTGCAGGGGGAAGC CATGAGCCTCTCATCAGGGCATTATCTGAAGATCTATCAAAAGTCGGTGACGGTAAATTC CAAGTGGTAGTCCTTAATGCTAGAGGTTGCTCAAGATCTAAAGTCACCACCCGTAGAATC TTTACCGCATTACACACAGGTGATGTGAGAGAATTTTTGAACCACCAAAAAGCTCTATTT CCGCAAAGAAAAATATATGCAGTCGGAACATCATTTGGAGCAGCCATGCTAACGAACTAC TTAGGTGAAGAAGGAGATAACTGTCCATTAAATGCTGCAGTCGCTCTCTCAAACCCATGG GATTTCGTACACACTTGGGACAAGTTGGCTCATGATTGGTGGTCCAACCATATTTTTTCT AGAACTTTAACACAATTTCTAACAAGGACTGTCAAGGTTAATATGAATGAGTTGCAGGTA CCAGAGAATTTTGAGGTTTCGCACAAACCGACAGTTGAGAAACCAGTCTTTTATACGTAT ACCAGAGAAAATTTGGAAAAGGCTGAAAAATTTACAGACATATTAGAATTCGATAATCTT TTCACTGCCCCATCGATGGGCCTGCCGGACGGGTTAACATATTATAGAAAGGCCAGTTCG ATAAATAGATTGCCTAATATCAAAATCCCAACTTTAATAATCAACGCAACGGATGATCCA GTTACAGGTGAAAACGTAATTCCGTACAAACAAGCTAGAGAAAATCCTTGTGTGTTGTTA TGCGAGACTGACTTGGGTGGACATTTGGCTTATCTCGACAATGAAAGTAATTCCTGGTTA ACAAAGCAAGCTGCCGAGTTCTTGGGCAGCTTTGATGAGTTAGTTTTATAA
Protein Properties
Pfam Domain Function
Protein Residues456
Protein Molecular Weight51723.19922
Protein Theoretical pI7.69
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Medium-chain fatty acid ethyl ester synthase/esterase 1 MFRSGYYPTVTPSHWGYNGTVKHVLGEKGTKSLAFRDSKRQIPLHEFVTKHVPTLKDGAN FRLNSLLFTGYLQTLYLSAGDFSKKFQVFYGREIIKFSDGGVCTADWVMPEWEQTYSLNA EKASFNEKQFSNDEKATHPKGWPRLHPRTRYLSSEELEKCHSKGYSYPLVVVLHGLAGGS HEPLIRALSEDLSKVGDGKFQVVVLNARGCSRSKVTTRRIFTALHTGDVREFLNHQKALF PQRKIYAVGTSFGAAMLTNYLGEEGDNCPLNAAVALSNPWDFVHTWDKLAHDWWSNHIFS RTLTQFLTRTVKVNMNELQVPENFEVSHKPTVEKPVFYTYTRENLEKAEKFTDILEFDNL FTAPSMGLPDGLTYYRKASSINRLPNIKIPTLIINATDDPVTGENVIPYKQARENPCVLL CETDLGGHLAYLDNESNSWLTKQAAEFLGSFDELVL
References
External Links
ResourceLink
Saccharomyces Genome Database EEB1
Uniprot IDQ02891
Uniprot NameMCFS1_YEAST
GenBank Gene IDAY692561
Genebank Protein ID51012573
General Reference
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Saerens, S. M., Verstrepen, K. J., Van Laere, S. D., Voet, A. R., Van Dijck, P., Delvaux, F. R., Thevelein, J. M. (2006). "The Saccharomyces cerevisiae EHT1 and EEB1 genes encode novel enzymes with medium-chain fatty acid ethyl ester synthesis and hydrolysis capacity." J Biol Chem 281:4446-4456.16361250