Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePutative mitochondrial carnitine O-acetyltransferase
SynonymsNot Available
Gene NameYAT1
Enzyme Class
Biological Properties
General FunctionInvolved in acyltransferase activity
Specific FunctionInvolved in the transfer of acetyl-CoA into mitochondria. May also be involved in the metabolism of acetate and of ethanol
Cellular LocationMitochondrion inner membrane; Peripheral membrane protein; Intermembrane side
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
(R)-Carnitine + Acetyl-CoAO-acetylcarnitinium + Coenzyme A
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00188L-CarnitineShow
YMDB00312Acetyl-CoAShow
YMDB00351L-AcetylcarnitineShow
YMDB00438S-Adenosyl-L-methionineShow
YMDB00616(R)-CarnitineShow
YMDB00617O-acetylcarnitiniumShow
GO Classification
Component
Not Available
Function
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
acyltransferase activity
catalytic activity
transferase activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 1
LocusYAR035W
Gene Sequence>2064 bp ATGCCAAACTTAAAGAGACTACCCATCCCGCCACTGCAGGACACGCTCAACCGCTACCTG GCACGCGTGGAACCCCTGCAGGACGAGCGCCAAAACCGCCGTACGCGCCGCACTGTGCTC TCCGCAGAAAACCTGGACGCATTGAACACGCTGCACGAGCGGCTGCTAGAATACGACGCA CGGCTCGCGGAAAGCAACCCAGAGTCCTCATACATCGAGCAGTTCTGGTATGACGCGTAC TTGCTATATGATGCAACTGTCGTTCTCAACGTCAACCCGTACTTCCAACTGCAGGACGAC CCAACCATCAAAGACACACCAGAGACGGCGGCACAGGGCCCCTATGGCGCACACACGGTG CAGGTTCGTCGTGCCGCACGACTCACCACCTCTATTCTCAAGTTCATCCGCCAGATTCGC CACGGCACACTCCGCACAGACACTGTGCGCGGCAAAACGCCGCTGTCGATGGACCAGTAT GAGCGGCTATTCGGCTCCAGTAGAATCCCTCCGGGTCCCGGCGAGCCCTCTTGCCACTTG CAAACAGACGCCACGTCGCATCACGTGGTGGCGATGTATCGTGGCCAGTTCTACTGGTTC GACGTGCTGGACACACGCAACGAGCCCATCTTCGCCACCCCAGAACAACTGGAGTGGAAC CTCTACTCGATCATCATGGACGCGGAATCCGCCGGAAGCGGATCCGCGCCCTTTGGCGTG TTCACCACAGAGTCGCGCCGGGTGTGGTCCAACATCAGGGACTATCTGTTCCATGCGGAC GACTGCACCAACTGGCGCAATCTCAAGCTGATCGACTCCGCGCTGTTCGTGGTCTGTCTC GACGACGTGGCGTTTGCCGCCGATCAGCAGGACGAGCTCACGCGTTCGATGCTGTGCGGG ACTTCTACCATCAATCTCGACCCGCACCAACACCAGCCGCCATTGAACGTGCAGACAGGC ACCTGTCTCAACCGCTGGTACGACAAGTTACAACTGATCGTGACCAAGAACGGTAAGGCG GGCATCAACTTCGAACACACCGGTGTGGACGGCCACACTGTGCTGCGGCTCGCCACAGAC ATCTACACAGACTCGATCCTGAGCTTCGCACGCGGTGTCACCAAGAACGTCGTCGACATC TTTAGCGACGACGATGGAAAACCATCGTCGTCGTCGTTGGCCTCGGCGGCTCACTCCGCC AACTTGATCACCATCCCTCGTAAACTGGAATGGCGCACTGACAATTTCCTGCAATCGTCG CTGCACTTTGCCGAGACGCGCATCTCGGACTTGATCTCGCAATACGAGTTTGTTAATCTT GACTTCTCCAACTACGGCGCGTCCCATATCAAGACAGTGTTCAAGTGCTCGCCAGACGCC TTCGTGCAGCAGGTGTTCCAGGTCGCATACTTCGCGTTGTACGGTCGCTTCGAGACCGTG TACGAGCCTGCCATGACCAAGGCGTTCCAAAACGGCCGCACAGAGGCCATCCGCTCCGTC ACGGGCCAATCGAAGCTCTTTGTCAAGTCACTACTGGACCAGGATGCCTCGGACGCCACC AAAATTCAGCTCTTGCACGACGCCTGTACGGCGCACTCGCAAATCACAAGGGAATGCTCC CAGGGGCTCGGCCAGGACCGTCACTTGTATGCGCTCTACTGCCTCTGGAACCAATGGTAC AAGGACAAGTTGGAGCTCCCACCCATCTTCCGCGACAAGTCCTGGACTACCATGCAGAAC AACGTCTTGAGCACCTCCAACTGCGGTAACCCCTGCCTCAAGAGCTTCGGGTTCGGGCCT GTCACCGCCAACGGCTTCGGCATCGGCTACATCATCAGAGACCACTCCGTCTCTGTGGTG GTGTCCTCAAGGCATCGCCAGACTGCTCGGTTTGCGTCGCTCATGGAAAAGTCGCTGCTG GAGATCGACCGCATCTTCAAACGGCAGCAAGCTCGCGCAGCAAAACCCGCTGCCAGGACC ACTGCTAGCGCCAACACCAAATCAGAAGACATGAAATACCTGTTGTCCGGCTACGATTAC TTCGACGTGAGCGTGTCCGGTTGA
Protein Properties
Pfam Domain Function
Protein Residues687
Protein Molecular Weight77764.79688
Protein Theoretical pI6.92
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Putative mitochondrial carnitine O-acetyltransferase MPNLKRLPIPPLQDTLNRYLARVEPLQDERQNRRTRRTVLSAENLDALNTLHERLLEYDA RLAESNPESSYIEQFWYDAYLLYDATVVLNVNPYFQLQDDPTIKDTPETAAQGPYGAHTV QVRRAARLTTSILKFIRQIRHGTLRTDTVRGKTPLSMDQYERLFGSSRIPPGPGEPSCHL QTDATSHHVVAMYRGQFYWFDVLDTRNEPIFATPEQLEWNLYSIIMDAESAGSGSAPFGV FTTESRRVWSNIRDYLFHADDCTNWRNLKLIDSALFVVCLDDVAFAADQQDELTRSMLCG TSTINLDPHQHQPPLNVQTGTCLNRWYDKLQLIVTKNGKAGINFEHTGVDGHTVLRLATD IYTDSILSFARGVTKNVVDIFSDDDGKPSSSSLASAAHSANLITIPRKLEWRTDNFLQSS LHFAETRISDLISQYEFVNLDFSNYGASHIKTVFKCSPDAFVQQVFQVAYFALYGRFETV YEPAMTKAFQNGRTEAIRSVTGQSKLFVKSLLDQDASDATKIQLLHDACTAHSQITRECS QGLGQDRHLYALYCLWNQWYKDKLELPPIFRDKSWTTMQNNVLSTSNCGNPCLKSFGFGP VTANGFGIGYIIRDHSVSVVVSSRHRQTARFASLMEKSLLEIDRIFKRQQARAAKPAART TASANTKSEDMKYLLSGYDYFDVSVSG
References
External Links
ResourceLink
Saccharomyces Genome Database YAT1
Uniprot IDP80235
Uniprot NameCACM_YEAST
GenBank Gene IDL28920
Genebank Protein ID456138
General Reference
  • Schmalix, W., Bandlow, W. (1993). "The ethanol-inducible YAT1 gene from yeast encodes a presumptive mitochondrial outer carnitine acetyltransferase." J Biol Chem 268:27428-27439.8262985
  • Bussey, H., Kaback, D. B., Zhong, W., Vo, D. T., Clark, M. W., Fortin, N., Hall, J., Ouellette, B. F., Keng, T., Barton, A. B., et, a. l. .. (1995). "The nucleotide sequence of chromosome I from Saccharomyces cerevisiae." Proc Natl Acad Sci U S A 92:3809-3813.7731988
  • Reinders, J., Wagner, K., Zahedi, R. P., Stojanovski, D., Eyrich, B., van der Laan, M., Rehling, P., Sickmann, A., Pfanner, N., Meisinger, C. (2007). "Profiling phosphoproteins of yeast mitochondria reveals a role of phosphorylation in assembly of the ATP synthase." Mol Cell Proteomics 6:1896-1906.17761666