You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCytochrome P450 61
Synonyms
  • C-22 sterol desaturase
Gene NameERG5
Enzyme ClassNot Available
Biological Properties
General FunctionSecondary metabolites biosynthesis, transport and catabolism
Specific FunctionRequired to form the C-22(23) double bond in the sterol side chain
Cellular LocationNot Available
SMPDB Pathways
Cholesterol biosynthesis and metabolism CE(10:0)PW002545 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(14:0)PW002544 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(18:0)PW002551 ThumbThumb?image type=greyscaleThumb?image type=simple
Steroid biosynthesisPW002482 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Steroid biosynthesisec00100 Map00100
SMPDB Reactions
5,7,24(28)-Ergostatrienol + hydron + NADPH + oxygenergosta-5,7,22,24(28)-tetraen-3beta-ol + NADP + water
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00606ergosta-5,7,22,24(28)-tetraen-3beta-olShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00900oxygenShow
YMDB163215,7,24(28)-ErgostatrienolShow
GO Classification
Function
electron carrier activity
iron ion binding
monooxygenase activity
binding
ion binding
cation binding
metal ion binding
transition metal ion binding
catalytic activity
oxidoreductase activity
heme binding
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>1617 bp ATGAGTTCTGTCGCAGAAAATATAATACAACATGCCACTCATAATTCTACGCTACACCAA TTGGCTAAAGACCAGCCCTCTGTAGGCGTCACTACTGCCTTCAGTATCCTGGATACACTT AAGTCTATGTCATATTTGAAAATATTTGCTACTTTAATCTGTATTCTTTTGGTTTGGGAC CAAGTTGCATATCAAATCAAGAAAGGTTCCATCGCAGGTCCAAAGTTTAAGTTCTGGCCC ATCATCGGTCCATTTTTGGAATCCTTAGATCCAAAGTTTGAAGAATATAAGGCTAAGTGG GCATCCGGTCCACTTTCATGTGTTTCTATTTTCCATAAATTTGTTGTTATCGCATCTACT AGAGACTTGGCAAGAAAGATCTTGCAATCTTCCAAATTCGTCAAACCTTGCGTTGTCGAT GTTGCTGTGAAGATCTTAAGACCTTGCAATTGGGTTTTTTTGGACGGTAAAGCTCATACT GATTACAGAAAATCATTAAACGGTCTTTTCACTAAACAAGCTTTGGCTCAATACTTACCT TCATTGGAACAAATCATGGATAAGTACATGGATAAGTTTGTTCGTTTATCTAAGGAGAAT AACTACGAGCCCCAGGTCTTTTTCCATGAAATGAGAGAAATTCTTTGCGCCTTATCATTG AACTCTTTCTGTGGTAACTATATTACCGAAGATCAAGTCAGAAAGATTGCTGATGATTAC TATTTGGTTACAGCAGCATTGGAATTAGTCAACTTCCCAATTATTATCCCTTACACTAAA ACATGGTATGGTAAGAAAACTGCAGACATGGCCATGAAGATTTTCGAAAACTGTGCTCAA ATGGCTAAGGATCATATTGCTGCAGGTGGTAAGCCAGTTTGTGTTATGGATGCTTGGTGT AAGTTGATGCACGATGCAAAGAATAGTAACGATGATGATTCTAGAATCTACCACAGAGAG TTTACTAACAAGGAAATCTCCGAAGCTGTTTTCACTTTCTTATTTGCTTCTCAAGATGCC TCTTCTTCTTTAGCTTGTTGGTTGTTCCAAATTGTTGCTGACCGTCCAGATGTCTTAGCT AAGATCAGAGAAGAACAATTGGCTGTTCGTAACAATGACATGTCTACCGAATTGAACTTG GATTTGATTGAGAAAATGAAGTACACCAATATGGTCATAAAAGAAACTTTGCGTTACAGA CCTCCTGTCTTGATGGTTCCATATGTTGTTAAGAAGAATTTCCCAGTTTCCCCTAACTAT ACCGCACCAAAGGGCGCTATGTTAATTCCAACCTTATACCCAGCTTTACATGATCCTGAA GTTTACGAAAATCCTGATGAGTTCATCCCTGAAAGATGGGTAGAAGGCTCTAAGGCTAGT GAAGCAAAGAAGAATTGGTTGGTTTTTGGTTGTGGTCCACACGTTTGCTTAGGTCAAACA TATGTCATGATTACCTTCGCCGCTTTGTTGGGTAAATTTGCACTATATACTGATTTCCAT CATACAGTGACTCCATTAAGTGAAAAAATCAAGGTTTTCGCTACAATTTTCCCAAAAGAT GATTTGTTACTGACTTTCAAAAAGAGAGACCCAATTACTGGAGAAGTCTTCGAATAA
Protein Properties
Pfam Domain Function
Protein Residues538
Protein Molecular Weight61333.80078
Protein Theoretical pI8.01
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Cytochrome P450 61 MSSVAENIIQHATHNSTLHQLAKDQPSVGVTTAFSILDTLKSMSYLKIFATLICILLVWD QVAYQIKKGSIAGPKFKFWPIIGPFLESLDPKFEEYKAKWASGPLSCVSIFHKFVVIAST RDLARKILQSSKFVKPCVVDVAVKILRPCNWVFLDGKAHTDYRKSLNGLFTKQALAQYLP SLEQIMDKYMDKFVRLSKENNYEPQVFFHEMREILCALSLNSFCGNYITEDQVRKIADDY YLVTAALELVNFPIIIPYTKTWYGKKTADMAMKIFENCAQMAKDHIAAGGKPVCVMDAWC KLMHDAKNSNDDDSRIYHREFTNKEISEAVFTFLFASQDASSSLACWLFQIVADRPDVLA KIREEQLAVRNNDMSTELNLDLIEKMKYTNMVIKETLRYRPPVLMVPYVVKKNFPVSPNY TAPKGAMLIPTLYPALHDPEVYENPDEFIPERWVEGSKASEAKKNWLVFGCGPHVCLGQT YVMITFAALLGKFALYTDFHHTVTPLSEKIKVFATIFPKDDLLLTFKKRDPITGEVFE
References
External Links
ResourceLink
Saccharomyces Genome Database ERG5
Uniprot IDP54781
Uniprot NameERG5_YEAST
GenBank Gene IDU34636
Genebank Protein ID1235991
General Reference
  • Skaggs, B. A., Alexander, J. F., Pierson, C. A., Schweitzer, K. S., Chun, K. T., Koegel, C., Barbuch, R., Bard, M. (1996). "Cloning and characterization of the Saccharomyces cerevisiae C-22 sterol desaturase gene, encoding a second cytochrome P-450 involved in ergosterol biosynthesis." Gene 169:105-109.8635732
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Kelly, S. L., Lamb, D. C., Corran, A. J., Baldwin, B. C., Parks, L. W., Kelly, D. E. (1995). "Purification and reconstitution of activity of Saccharomyces cerevisiae P450 61, a sterol delta 22-desaturase." FEBS Lett 377:217-220.8543054
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Peng, J., Schwartz, D., Elias, J. E., Thoreen, C. C., Cheng, D., Marsischky, G., Roelofs, J., Finley, D., Gygi, S. P. (2003). "A proteomics approach to understanding protein ubiquitination." Nat Biotechnol 21:921-926.12872131
  • Mo, C., Bard, M. (2005). "Erg28p is a key protein in the yeast sterol biosynthetic enzyme complex." J Lipid Res 46:1991-1998.15995173