You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase
Synonyms
  • Alpha-1,2-mannosyltransferase ALG11
  • Asparagine-linked glycosylation protein 11
  • Glycolipid 2-alpha-mannosyltransferase
Gene NameALG11
Enzyme ClassNot Available
Biological Properties
General Functionprotein glycosylation
Specific FunctionRequired for N-linked oligosaccharide assembly. Has a role in the last step of the synthesis of the Man(5)GlcNAc(2)-PP-dolichol core oligosaccharide on the cytoplasmic face of the endoplasmic reticulum.
Cellular LocationNot Available
SMPDB Pathways
N-Glycan biosynthesisPW002501 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
N-Glycan biosynthesisec00510 Map00510
SMPDB Reactions
(Mannosyl)3-(N-acetylglucosaminyl)2-diphosphodolichol + Guanosine diphosphate mannose(Mannosyl)5-(N-acetylglucosaminyl)2-diphosphodolichol + Guanosine diphosphate + hydron
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00202Guanosine diphosphate mannoseShow
YMDB00257Guanosine diphosphateShow
YMDB00862hydronShow
YMDB16226(Mannosyl)3-(N-acetylglucosaminyl)2-diphosphodolicholShow
YMDB16227(Mannosyl)5-(N-acetylglucosaminyl)2-diphosphodolicholShow
GO Classification
Function
integral component of membrane
endoplasmic reticulum membrane
dolichol-linked oligosaccharide biosynthetic process
oligosaccharide-lipid intermediate biosynthetic process
protein glycosylation
alpha-1,2-mannosyltransferase activity
GDP-Man:Man3GlcNAc2-PP-Dol alpha-1,2-mannosyltransferase activity
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>1647 bp ATGGGCAGTGCTTGGACAAACTACAATTTTGAAGAGGTTAAGTCTCATTTTGGGTTCAAA AAATATGTTGTATCATCTTTAGTACTAGTGTATGGACTAATTAAGGTTCTCACGTGGATC TTCCGTCAATGGGTGTATTCCAGCTTGAATCCGTTCTCCAAAAAATCTTCATTACTGAAC AGAGCAGTTGCCTCCTGTGGTGAGAAGAATGTGAAAGTTTTTGGTTTTTTTCATCCGTAT TGTAATGCTGGTGGTGGTGGGGAAAAAGTGCTCTGGAAAGCTGTAGATATCACTTTGAGA AAAGATGCTAAGAACGTTATTGTCATTTATTCAGGGGATTTTGTGAATGGAGAGAATGTT ACTCCGGAGAATATTCTAAATAATGTGAAAGCGAAGTTCGATTACGACTTGGATTCGGAT AGAATATTTTTCATTTCATTGAAGCTAAGATACTTGGTGGATTCTTCAACATGGAAGCAT TTCACGTTGATTGGACAAGCAATTGGATCAATGATTCTCGCATTTGAATCCATTATTCAG TGTCCACCTGATATATGGATTGATACAATGGGGTACCCTTTCAGCTATCCTATTATTGCT AGGTTTTTGAGGAGAATTCCTATCGTCACATATACGCATTATCCGATAATGTCAAAAGAC ATGTTAAATAAGCTGTTCAAAATGCCCAAGAAGGGTATCAAAGTTTACGGTAAAATATTA TACTGGAAAGTTTTTATGTTAATTTATCAATCCATTGGTTCTAAAATTGATATTGTAATC ACAAACTCAACATGGACAAATAACCACATAAAGCAAATTTGGCAATCCAATACGTGTAAA ATTATATATCCTCCATGCTCTACTGAGAAATTAGTAGATTGGAAGCAAAAGTTTGGTACT GCAAAGGGTGAGAGATTAAATCAAGCAATTGTGTTGGCACAATTTCGTCCTGAGAAACGT CATAAGTTAATCATTGAGTCCTTTGCAACTTTCTTGAAAAATTTACCGGATTCTGTATCG CCAATTAAATTGATAATGGCGGGGTCCACTAGATCCAAGCAAGATGAAAATTATGTTAAA AGTTTACAAGACTGGTCAGAAAATGTATTAAAAATTCCTAAACATTTGATATCATTCGAA AAAAATCTGCCCTTCGATAAGATTGAAATATTACTAAACAAATCTACTTTCGGTGTTAAT GCCATGTGGAATGAGCACTTTGGAATTGCAGTTGTAGAGTATATGGCTTCCGGTTTGATC CCCATAGTTCATGCCTCGGCGGGCCCATTGTTAGATATAGTTACTCCATGGGATGCCAAC GGGAATATCGGAAAAGCTCCACCACAATGGGAGTTACAAAAGAAATATTTTGCAAAACTC GAAGATGATGGTGAAACTACTGGATTTTTCTTTAAAGAGCCGAGTGATCCTGATTATAAC ACAACCAAAGATCCTCTGAGATACCCTAATTTGTCCGACCTTTTCTTACAAATTACGAAA CTGGACTATGACTGCCTAAGGGTGATGGGCGCAAGAAACCAGCAGTATTCATTGTATAAA TTCTCTGATTTGAAGTTTGATAAAGATTGGGAAAACTTTGTACTGAATCCTATTTGTAAA TTATTAGAAGAGGAGGAAAGGGGCTGA
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues548
Protein Molecular Weight63142.705
Protein Theoretical pINot Available
Signalling RegionsNot Available
Transmembrane Regions
  • 21-41
Protein Sequence>GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase MGSAWTNYNFEEVKSHFGFKKYVVSSLVLVYGLIKVLTWIFRQWVYSSLNPFSKKSSLLN RAVASCGEKNVKVFGFFHPYCNAGGGGEKVLWKAVDITLRKDAKNVIVIYSGDFVNGENV TPENILNNVKAKFDYDLDSDRIFFISLKLRYLVDSSTWKHFTLIGQAIGSMILAFESIIQ CPPDIWIDTMGYPFSYPIIARFLRRIPIVTYTHYPIMSKDMLNKLFKMPKKGIKVYGKIL YWKVFMLIYQSIGSKIDIVITNSTWTNNHIKQIWQSNTCKIIYPPCSTEKLVDWKQKFGT AKGERLNQAIVLAQFRPEKRHKLIIESFATFLKNLPDSVSPIKLIMAGSTRSKQDENYVK SLQDWSENVLKIPKHLISFEKNLPFDKIEILLNKSTFGVNAMWNEHFGIAVVEYMASGLI PIVHASAGPLLDIVTPWDANGNIGKAPPQWELQKKYFAKLEDDGETTGFFFKEPSDPDYN TTKDPLRYPNLSDLFLQITKLDYDCLRVMGARNQQYSLYKFSDLKFDKDWENFVLNPICK LLEEEERG
References
External Links
ResourceLink
Saccharomyces Genome Database ALG11
Uniprot IDP53954
Uniprot NameALG11
General ReferenceNot Available